274783

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 48631..49274 Replicon plasmid pESI
Accession NZ_CP120338
Organism Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_6_2021

Toxin (Protein)


Gene name vagD Uniprot ID A0A5T8FJ24
Locus tag P1833_RS24090 Protein ID WP_023994137.1
Coordinates 48631..49047 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A5T3Q059
Locus tag P1833_RS24095 Protein ID WP_023994136.1
Coordinates 49044..49274 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1833_RS24060 (P1833_24060) 44111..44902 + 792 WP_023994142.1 F4 (K88) fimbria minor subunit FaeH -
P1833_RS24065 (P1833_24065) 44930..45694 + 765 WP_023994141.1 minor fimbrial protein -
P1833_RS24070 (P1833_24070) 45897..46487 + 591 WP_023994140.1 hypothetical protein -
P1833_RS24075 (P1833_24075) 46553..46765 + 213 WP_023994139.1 FaeA/PapI family transcriptional regulator -
P1833_RS24080 (P1833_24080) 47026..47187 + 162 WP_001816720.1 hypothetical protein -
P1833_RS24085 (P1833_24085) 47213..48061 + 849 WP_023994138.1 SdiA-regulated domain-containing protein -
P1833_RS24090 (P1833_24090) 48631..49047 - 417 WP_023994137.1 type II toxin-antitoxin system VapC family toxin Toxin
P1833_RS24095 (P1833_24095) 49044..49274 - 231 WP_023994136.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
P1833_RS24100 (P1833_24100) 49898..50116 + 219 WP_023994135.1 type II toxin-antitoxin system antitoxin CcdA -
P1833_RS24105 (P1833_24105) 50118..50423 + 306 WP_023994134.1 type II toxin-antitoxin system toxin CcdB -
P1833_RS24110 (P1833_24110) 50425..50715 + 291 WP_023994133.1 hypothetical protein -
P1833_RS24115 (P1833_24115) 50712..50987 + 276 Protein_59 3'-5' exonuclease -
P1833_RS24120 (P1833_24120) 51058..51174 + 117 Protein_60 hypothetical protein -
P1833_RS24125 (P1833_24125) 51164..51879 - 716 Protein_61 transposase -
P1833_RS24130 (P1833_24130) 53161..53697 + 537 WP_023994130.1 fimbrial protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(3'')-Ia / qacE / sul1 / tet(A) / dfrA14 faeC / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS 1..285085 285085


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15123.58 Da        Isoelectric Point: 8.5291

>T274783 WP_023994137.1 NZ_CP120338:c49047-48631 [Salmonella enterica subsp. enterica serovar Muenchen]
VKKMYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVNATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWGR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8650.75 Da        Isoelectric Point: 4.5881

>AT274783 WP_023994136.1 NZ_CP120338:c49274-49044 [Salmonella enterica subsp. enterica serovar Muenchen]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLEKADPGFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5T8FJ24

Antitoxin

Source ID Structure
AlphaFold DB A0A5T3Q059

References