Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacT-ataR/DUF1778(antitoxin)
Location 28612..29369 Replicon plasmid pESI
Accession NZ_CP120338
Organism Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_6_2021

Toxin (Protein)


Gene name tacT Uniprot ID A0A241PXX4
Locus tag P1833_RS23970 Protein ID WP_023994162.1
Coordinates 28887..29369 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name ataR Uniprot ID A0A727Z1I8
Locus tag P1833_RS23965 Protein ID WP_001195098.1
Coordinates 28612..28896 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1833_RS23920 (P1833_23920) 24453..24599 - 147 Protein_20 IS66 family insertion sequence element accessory protein TnpB -
P1833_RS23925 (P1833_23925) 24586..24915 - 330 WP_023994169.1 hypothetical protein -
P1833_RS23930 (P1833_23930) 25039..25892 + 854 Protein_22 site-specific tyrosine recombinase XerC -
P1833_RS23935 (P1833_23935) 25861..26148 + 288 WP_031619580.1 damage-inducible protein J -
P1833_RS23940 (P1833_23940) 26145..26450 + 306 WP_023994167.1 type II toxin-antitoxin system RelE/ParE family toxin -
P1833_RS23945 (P1833_23945) 27200..27463 + 264 WP_023994165.1 DUF977 family protein -
P1833_RS23950 (P1833_23950) 27489..27824 + 336 WP_023994164.1 hypothetical protein -
P1833_RS23955 (P1833_23955) 28046..28243 - 198 Protein_27 PIN domain-containing protein -
P1833_RS23960 (P1833_23960) 28367..28456 + 90 WP_071790431.1 helix-turn-helix domain-containing protein -
P1833_RS23965 (P1833_23965) 28612..28896 + 285 WP_001195098.1 DUF1778 domain-containing protein Antitoxin
P1833_RS23970 (P1833_23970) 28887..29369 + 483 WP_023994162.1 GNAT family N-acetyltransferase Toxin
P1833_RS23975 (P1833_23975) 29684..30110 + 427 Protein_31 transposase -
P1833_RS23980 (P1833_23980) 30427..30636 + 210 WP_023994160.1 hemolysin expression modulator Hha -
P1833_RS23985 (P1833_23985) 30710..31062 - 353 Protein_33 transposase -
P1833_RS23990 (P1833_23990) 31289..32262 + 974 Protein_34 IS256 family transposase -
P1833_RS23995 (P1833_23995) 32264..32506 + 243 WP_023994156.1 hypothetical protein -
P1833_RS24000 (P1833_24000) 32577..33533 + 957 WP_023994155.1 Rpn family recombination-promoting nuclease/putative transposase -
P1833_RS24005 (P1833_24005) 33592..33804 + 213 WP_023994154.1 hypothetical protein -
P1833_RS24010 (P1833_24010) 33846..34097 - 252 WP_023994153.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(3'')-Ia / qacE / sul1 / tet(A) / dfrA14 faeC / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS 1..285085 285085
- inside IScluster/Tn - - 23157..35661 12504


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(31-149)

Antitoxin

Vibrio phage ICP1, Orf50

(13-88)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17971.54 Da        Isoelectric Point: 6.8521

>T274782 WP_023994162.1 NZ_CP120338:28887-29369 [Salmonella enterica subsp. enterica serovar Muenchen]
MEISVTAPELLNEEHYLQQFDCGNDVLSDWLRRRAMKNQYLNASRTFVICPEGTKRVVGYYSIATGSVSHASLGRSLRQN
MPDPVPVVLLGRLAVDECTQGHSFGKWLLNDAVTRVSNLADQVGIKAIMVHAIDEQAKTFYEYFGFVQSPIAPNTLFYKI

Download         Length: 483 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10964.52 Da        Isoelectric Point: 9.6539

>AT274782 WP_001195098.1 NZ_CP120338:28612-28896 [Salmonella enterica subsp. enterica serovar Muenchen]
MQTTIRKSVRNKQINIRATDEERAVIDYAASLVSKNRTDFIIEKAVSEAQNIILDQRVFVLDDARYQAFIKQLEAPVQNT
EGRQRLMDVKPEWK

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A241PXX4

Antitoxin

Source ID Structure
AlphaFold DB A0A727Z1I8

References