Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 14532..15122 | Replicon | plasmid pESI |
Accession | NZ_CP120338 | ||
Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_6_2021 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A241PXU0 |
Locus tag | P1833_RS23885 | Protein ID | WP_023994178.1 |
Coordinates | 14790..15122 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A5T3Q5H6 |
Locus tag | P1833_RS23880 | Protein ID | WP_023994179.1 |
Coordinates | 14532..14789 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1833_RS23860 (P1833_23860) | 10031..11056 | + | 1026 | WP_023994180.1 | IS630 family transposase | - |
P1833_RS23865 (P1833_23865) | 11060..12079 | - | 1020 | WP_223155817.1 | hypothetical protein | - |
P1833_RS23870 (P1833_23870) | 12219..12725 | - | 507 | WP_223155815.1 | hypothetical protein | - |
P1833_RS23875 (P1833_23875) | 12836..13921 | - | 1086 | WP_223155813.1 | hypothetical protein | - |
P1833_RS23880 (P1833_23880) | 14532..14789 | + | 258 | WP_023994179.1 | hypothetical protein | Antitoxin |
P1833_RS23885 (P1833_23885) | 14790..15122 | + | 333 | WP_023994178.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
P1833_RS23890 (P1833_23890) | 15722..16327 | + | 606 | Protein_14 | IS481 family transposase | - |
P1833_RS23895 (P1833_23895) | 16626..18848 | - | 2223 | WP_023994175.1 | DEAD/DEAH box helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | ant(3'')-Ia / qacE / sul1 / tet(A) / dfrA14 | faeC / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS | 1..285085 | 285085 | |
- | inside | IScluster/Tn | - | - | 10019..16327 | 6308 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11787.54 Da Isoelectric Point: 9.3417
>T274781 WP_023994178.1 NZ_CP120338:14790-15122 [Salmonella enterica subsp. enterica serovar Muenchen]
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGDFARTAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPEAVVNEVLARLEAILS
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGDFARTAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPEAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A241PXU0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5T3Q5H6 |