Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4216539..4217055 | Replicon | chromosome |
Accession | NZ_CP120337 | ||
Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_6_2021 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C0Q7A9 |
Locus tag | P1833_RS20795 | Protein ID | WP_000220578.1 |
Coordinates | 4216539..4216823 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | P1833_RS20800 | Protein ID | WP_000212724.1 |
Coordinates | 4216813..4217055 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1833_RS20780 (4211655) | 4211655..4213307 | + | 1653 | WP_021294549.1 | alpha,alpha-phosphotrehalase | - |
P1833_RS20785 (4213716) | 4213716..4215854 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
P1833_RS20790 (4216071) | 4216071..4216535 | + | 465 | WP_001009173.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
P1833_RS20795 (4216539) | 4216539..4216823 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P1833_RS20800 (4216813) | 4216813..4217055 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
P1833_RS20805 (4217133) | 4217133..4219046 | - | 1914 | WP_001212145.1 | BglG family transcription antiterminator | - |
P1833_RS20810 (4219063) | 4219063..4219803 | - | 741 | WP_000779259.1 | KDGP aldolase family protein | - |
P1833_RS20815 (4219800) | 4219800..4220918 | - | 1119 | WP_023197793.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
P1833_RS20820 (4220902) | 4220902..4222035 | - | 1134 | WP_017465838.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T274778 WP_000220578.1 NZ_CP120337:c4216823-4216539 [Salmonella enterica subsp. enterica serovar Muenchen]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E876 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |