Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 49898..50423 Replicon plasmid pESI
Accession NZ_CP120336
Organism Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_7_2021

Toxin (Protein)


Gene name ccdB Uniprot ID A0A5Y5FBU7
Locus tag P1829_RS24060 Protein ID WP_023994134.1
Coordinates 50118..50423 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A5T8X4Y4
Locus tag P1829_RS24055 Protein ID WP_023994135.1
Coordinates 49898..50116 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1829_RS24020 (P1829_24020) 44930..45694 + 765 WP_023994141.1 minor fimbrial protein -
P1829_RS24025 (P1829_24025) 45897..46487 + 591 WP_023994140.1 hypothetical protein -
P1829_RS24030 (P1829_24030) 46553..46765 + 213 WP_023994139.1 FaeA/PapI family transcriptional regulator -
P1829_RS24035 (P1829_24035) 47026..47187 + 162 WP_001816720.1 hypothetical protein -
P1829_RS24040 (P1829_24040) 47213..48061 + 849 WP_023994138.1 SdiA-regulated domain-containing protein -
P1829_RS24045 (P1829_24045) 48631..49047 - 417 WP_023994137.1 type II toxin-antitoxin system VapC family toxin -
P1829_RS24050 (P1829_24050) 49044..49274 - 231 WP_023994136.1 type II toxin-antitoxin system VapB family antitoxin -
P1829_RS24055 (P1829_24055) 49898..50116 + 219 WP_023994135.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
P1829_RS24060 (P1829_24060) 50118..50423 + 306 WP_023994134.1 type II toxin-antitoxin system toxin CcdB Toxin
P1829_RS24065 (P1829_24065) 50425..50715 + 291 WP_023994133.1 hypothetical protein -
P1829_RS24070 (P1829_24070) 50712..50987 + 276 Protein_59 3'-5' exonuclease -
P1829_RS24075 (P1829_24075) 51058..51174 + 117 Protein_60 hypothetical protein -
P1829_RS24080 (P1829_24080) 51164..51879 - 716 Protein_61 transposase -
P1829_RS24085 (P1829_24085) 53161..53697 + 537 WP_023994130.1 fimbrial protein -
P1829_RS24090 (P1829_24090) 53750..54481 + 732 WP_023994129.1 fimbria/pilus periplasmic chaperone -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(3'')-Ia / qacE / sul1 / tet(A) / dfrA14 faeC / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS 1..285072 285072


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11708.47 Da        Isoelectric Point: 6.4685

>T274766 WP_023994134.1 NZ_CP120336:50118-50423 [Salmonella enterica subsp. enterica serovar Muenchen]
MQFKVYTYKRESRYRLFVDVQSDIVDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRLMTTDMASVPASFIGEEV
AELSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8261.18 Da        Isoelectric Point: 4.7405

>AT274766 WP_023994135.1 NZ_CP120336:49898-50116 [Salmonella enterica subsp. enterica serovar Muenchen]
MKQRITVTIDSDSYQLLKSADVNISGLVNTAMQKEARRLRAERWQAENQEGMAEVARFIEANGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Y5FBU7

Antitoxin

Source ID Structure
AlphaFold DB A0A5T8X4Y4

References