Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4216381..4216897 | Replicon | chromosome |
Accession | NZ_CP120335 | ||
Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_7_2021 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C0Q7A9 |
Locus tag | P1829_RS20750 | Protein ID | WP_000220578.1 |
Coordinates | 4216381..4216665 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | P1829_RS20755 | Protein ID | WP_000212724.1 |
Coordinates | 4216655..4216897 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1829_RS20735 (4211497) | 4211497..4213149 | + | 1653 | WP_021294549.1 | alpha,alpha-phosphotrehalase | - |
P1829_RS20740 (4213558) | 4213558..4215696 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
P1829_RS20745 (4215913) | 4215913..4216377 | + | 465 | WP_001009173.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
P1829_RS20750 (4216381) | 4216381..4216665 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P1829_RS20755 (4216655) | 4216655..4216897 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
P1829_RS20760 (4216975) | 4216975..4218888 | - | 1914 | WP_001212145.1 | BglG family transcription antiterminator | - |
P1829_RS20765 (4218905) | 4218905..4219645 | - | 741 | WP_000779259.1 | KDGP aldolase family protein | - |
P1829_RS20770 (4219642) | 4219642..4220760 | - | 1119 | WP_023197793.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
P1829_RS20775 (4220744) | 4220744..4221877 | - | 1134 | WP_017465838.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T274760 WP_000220578.1 NZ_CP120335:c4216665-4216381 [Salmonella enterica subsp. enterica serovar Muenchen]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E876 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |