Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4216540..4217056 | Replicon | chromosome |
| Accession | NZ_CP120333 | ||
| Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_8_2021 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | C0Q7A9 |
| Locus tag | P1827_RS20740 | Protein ID | WP_000220578.1 |
| Coordinates | 4216540..4216824 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | P1827_RS20745 | Protein ID | WP_000212724.1 |
| Coordinates | 4216814..4217056 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1827_RS20725 (4211656) | 4211656..4213308 | + | 1653 | WP_021294549.1 | alpha,alpha-phosphotrehalase | - |
| P1827_RS20730 (4213717) | 4213717..4215855 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| P1827_RS20735 (4216072) | 4216072..4216536 | + | 465 | WP_001009173.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| P1827_RS20740 (4216540) | 4216540..4216824 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P1827_RS20745 (4216814) | 4216814..4217056 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| P1827_RS20750 (4217134) | 4217134..4219047 | - | 1914 | WP_001212145.1 | BglG family transcription antiterminator | - |
| P1827_RS20755 (4219064) | 4219064..4219804 | - | 741 | WP_000779259.1 | KDGP aldolase family protein | - |
| P1827_RS20760 (4219801) | 4219801..4220919 | - | 1119 | WP_023197793.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| P1827_RS20765 (4220903) | 4220903..4222036 | - | 1134 | WP_017465838.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T274742 WP_000220578.1 NZ_CP120333:c4216824-4216540 [Salmonella enterica subsp. enterica serovar Muenchen]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E876 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |