Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3521674..3522294 | Replicon | chromosome |
| Accession | NZ_CP120331 | ||
| Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_9_2021 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | P1832_RS17515 | Protein ID | WP_001280991.1 |
| Coordinates | 3522076..3522294 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | P1832_RS17510 | Protein ID | WP_000344807.1 |
| Coordinates | 3521674..3522048 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1832_RS17500 (3516813) | 3516813..3518006 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| P1832_RS17505 (3518029) | 3518029..3521178 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| P1832_RS17510 (3521674) | 3521674..3522048 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| P1832_RS17515 (3522076) | 3522076..3522294 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| P1832_RS17520 (3522473) | 3522473..3523024 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
| P1832_RS17525 (3523141) | 3523141..3523611 | + | 471 | WP_000136181.1 | YlaC family protein | - |
| P1832_RS17530 (3523667) | 3523667..3523807 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| P1832_RS17535 (3523813) | 3523813..3524073 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| P1832_RS17540 (3524298) | 3524298..3525848 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
| P1832_RS17550 (3526079) | 3526079..3526468 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| P1832_RS17555 (3526501) | 3526501..3527070 | - | 570 | WP_020437370.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T274720 WP_001280991.1 NZ_CP120331:3522076-3522294 [Salmonella enterica subsp. enterica serovar Muenchen]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT274720 WP_000344807.1 NZ_CP120331:3521674-3522048 [Salmonella enterica subsp. enterica serovar Muenchen]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|