Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4082905..4083421 | Replicon | chromosome |
Accession | NZ_CP120329 | ||
Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_PB_1_2021 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C0Q7A9 |
Locus tag | P1707_RS19690 | Protein ID | WP_000220578.1 |
Coordinates | 4082905..4083189 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | P1707_RS19695 | Protein ID | WP_000212724.1 |
Coordinates | 4083179..4083421 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1707_RS19675 (4078117) | 4078117..4079769 | + | 1653 | WP_000155045.1 | alpha,alpha-phosphotrehalase | - |
P1707_RS19680 (4080178) | 4080178..4082316 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
P1707_RS19685 (4082437) | 4082437..4082901 | + | 465 | WP_053445439.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
P1707_RS19690 (4082905) | 4082905..4083189 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P1707_RS19695 (4083179) | 4083179..4083421 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
P1707_RS19700 (4083499) | 4083499..4085412 | - | 1914 | WP_053445438.1 | BglG family transcription antiterminator | - |
P1707_RS19705 (4085429) | 4085429..4086169 | - | 741 | WP_053445437.1 | KDGP aldolase family protein | - |
P1707_RS19710 (4086166) | 4086166..4087284 | - | 1119 | WP_001139178.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
P1707_RS19715 (4087268) | 4087268..4088401 | - | 1134 | WP_053445436.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T274710 WP_000220578.1 NZ_CP120329:c4083189-4082905 [Salmonella enterica subsp. enterica serovar Muenchen]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E876 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |