Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3388012..3388632 | Replicon | chromosome |
Accession | NZ_CP120329 | ||
Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_PB_1_2021 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | P1707_RS16500 | Protein ID | WP_001280991.1 |
Coordinates | 3388414..3388632 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | P1707_RS16495 | Protein ID | WP_000344807.1 |
Coordinates | 3388012..3388386 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1707_RS16485 (3383151) | 3383151..3384344 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
P1707_RS16490 (3384367) | 3384367..3387516 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
P1707_RS16495 (3388012) | 3388012..3388386 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
P1707_RS16500 (3388414) | 3388414..3388632 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
P1707_RS16505 (3388811) | 3388811..3389362 | + | 552 | WP_053444946.1 | maltose O-acetyltransferase | - |
P1707_RS16510 (3389479) | 3389479..3389949 | + | 471 | WP_000136181.1 | YlaC family protein | - |
P1707_RS16515 (3390005) | 3390005..3390145 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
P1707_RS16520 (3390151) | 3390151..3390363 | - | 213 | WP_283903176.1 | 50S ribosomal protein L31 | - |
P1707_RS16525 (3390537) | 3390537..3392072 | + | 1536 | WP_023181050.1 | IS21 family transposase | - |
P1707_RS16530 (3392089) | 3392089..3392844 | + | 756 | WP_001282653.1 | IS21-like element ISSso4 family helper ATPase IstB | - |
P1707_RS16535 (3392938) | 3392938..3393057 | - | 120 | Protein_3234 | 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T274709 WP_001280991.1 NZ_CP120329:3388414-3388632 [Salmonella enterica subsp. enterica serovar Muenchen]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT274709 WP_000344807.1 NZ_CP120329:3388012-3388386 [Salmonella enterica subsp. enterica serovar Muenchen]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|