Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 2353150..2353672 | Replicon | chromosome |
| Accession | NZ_CP120329 | ||
| Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_PB_1_2021 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | A0A3Y0CYW1 |
| Locus tag | P1707_RS11510 | Protein ID | WP_053445270.1 |
| Coordinates | 2353150..2353434 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | V1H457 |
| Locus tag | P1707_RS11515 | Protein ID | WP_000885424.1 |
| Coordinates | 2353424..2353672 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1707_RS11485 (2348306) | 2348306..2349547 | - | 1242 | WP_001095738.1 | MFS transporter | - |
| P1707_RS11490 (2349537) | 2349537..2351045 | - | 1509 | WP_053445272.1 | FAD-dependent oxidoreductase | - |
| P1707_RS11495 (2351090) | 2351090..2351578 | + | 489 | WP_023258342.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| P1707_RS11500 (2351771) | 2351771..2352850 | + | 1080 | WP_053445271.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
| P1707_RS11505 (2352950) | 2352950..2353102 | - | 153 | Protein_2251 | Rid family hydrolase | - |
| P1707_RS11510 (2353150) | 2353150..2353434 | - | 285 | WP_053445270.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P1707_RS11515 (2353424) | 2353424..2353672 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| P1707_RS11520 (2354198) | 2354198..2354530 | + | 333 | WP_053445269.1 | DUF1493 family protein | - |
| P1707_RS11525 (2354819) | 2354819..2355100 | - | 282 | WP_001580000.1 | hypothetical protein | - |
| P1707_RS11530 (2355388) | 2355388..2356854 | - | 1467 | WP_077248432.1 | hypothetical protein | - |
| P1707_RS11535 (2357112) | 2357112..2358119 | + | 1008 | WP_053445268.1 | LacI family DNA-binding transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11074.91 Da Isoelectric Point: 10.8165
>T274708 WP_053445270.1 NZ_CP120329:c2353434-2353150 [Salmonella enterica subsp. enterica serovar Muenchen]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRKRLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRKRLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Y0CYW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0WPN5 |