Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 835846..836471 | Replicon | chromosome |
Accession | NZ_CP120329 | ||
Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_PB_1_2021 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | P1707_RS04065 | Protein ID | WP_000911337.1 |
Coordinates | 836073..836471 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | P1707_RS04060 | Protein ID | WP_000557549.1 |
Coordinates | 835846..836073 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1707_RS04030 (830909) | 830909..832007 | + | 1099 | WP_010989230.1 | peptide chain release factor 2 | - |
P1707_RS04035 (832017) | 832017..833534 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
P1707_RS04040 (833610) | 833610..834155 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
P1707_RS04045 (834420) | 834420..835178 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
P1707_RS04055 (835424) | 835424..835637 | - | 214 | Protein_793 | hypothetical protein | - |
P1707_RS04060 (835846) | 835846..836073 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
P1707_RS04065 (836073) | 836073..836471 | + | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
P1707_RS04070 (837276) | 837276..837812 | + | 537 | WP_053444818.1 | STM3031 family outer membrane protein | - |
P1707_RS04075 (837851) | 837851..838483 | + | 633 | WP_023232674.1 | YfdX family protein | - |
P1707_RS04080 (838803) | 838803..839558 | - | 756 | WP_001282653.1 | IS21-like element ISSso4 family helper ATPase IstB | - |
P1707_RS04085 (839575) | 839575..841110 | - | 1536 | WP_023181050.1 | IS21 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T274702 WP_000911337.1 NZ_CP120329:836073-836471 [Salmonella enterica subsp. enterica serovar Muenchen]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|