Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 124167..124692 Replicon plasmid pESI
Accession NZ_CP120328
Organism Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_10_2021

Toxin (Protein)


Gene name ccdB Uniprot ID A0A5Y5FBU7
Locus tag P1825_RS24505 Protein ID WP_023994134.1
Coordinates 124387..124692 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A5T8X4Y4
Locus tag P1825_RS24500 Protein ID WP_023994135.1
Coordinates 124167..124385 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1825_RS24465 (P1825_24465) 119199..119963 + 765 WP_023994141.1 minor fimbrial protein -
P1825_RS24470 (P1825_24470) 120166..120756 + 591 WP_023994140.1 hypothetical protein -
P1825_RS24475 (P1825_24475) 120822..121034 + 213 WP_023994139.1 FaeA/PapI family transcriptional regulator -
P1825_RS24480 (P1825_24480) 121295..121456 + 162 WP_001816720.1 hypothetical protein -
P1825_RS24485 (P1825_24485) 121482..122330 + 849 WP_023994138.1 SdiA-regulated domain-containing protein -
P1825_RS24490 (P1825_24490) 122900..123316 - 417 WP_023994137.1 type II toxin-antitoxin system VapC family toxin -
P1825_RS24495 (P1825_24495) 123313..123543 - 231 WP_023994136.1 type II toxin-antitoxin system VapB family antitoxin -
P1825_RS24500 (P1825_24500) 124167..124385 + 219 WP_023994135.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
P1825_RS24505 (P1825_24505) 124387..124692 + 306 WP_023994134.1 type II toxin-antitoxin system toxin CcdB Toxin
P1825_RS24510 (P1825_24510) 124694..124984 + 291 WP_023994133.1 hypothetical protein -
P1825_RS24515 (P1825_24515) 124981..125256 + 276 Protein_144 3'-5' exonuclease -
P1825_RS24520 (P1825_24520) 125327..125443 + 117 Protein_145 hypothetical protein -
P1825_RS24525 (P1825_24525) 125433..126148 - 716 Protein_146 transposase -
P1825_RS24530 (P1825_24530) 127430..127966 + 537 WP_023994130.1 fimbrial protein -
P1825_RS24535 (P1825_24535) 128019..128750 + 732 WP_023994129.1 fimbria/pilus periplasmic chaperone -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA14 / ant(3'')-Ia / qacE / sul1 / tet(A) faeC / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS 1..285079 285079


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11708.47 Da        Isoelectric Point: 6.4685

>T274699 WP_023994134.1 NZ_CP120328:124387-124692 [Salmonella enterica subsp. enterica serovar Muenchen]
MQFKVYTYKRESRYRLFVDVQSDIVDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRLMTTDMASVPASFIGEEV
AELSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8261.18 Da        Isoelectric Point: 4.7405

>AT274699 WP_023994135.1 NZ_CP120328:124167-124385 [Salmonella enterica subsp. enterica serovar Muenchen]
MKQRITVTIDSDSYQLLKSADVNISGLVNTAMQKEARRLRAERWQAENQEGMAEVARFIEANGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Y5FBU7

Antitoxin

Source ID Structure
AlphaFold DB A0A5T8X4Y4

References