Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 122900..123543 | Replicon | plasmid pESI |
| Accession | NZ_CP120328 | ||
| Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_10_2021 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A5T8FJ24 |
| Locus tag | P1825_RS24490 | Protein ID | WP_023994137.1 |
| Coordinates | 122900..123316 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A5T3Q059 |
| Locus tag | P1825_RS24495 | Protein ID | WP_023994136.1 |
| Coordinates | 123313..123543 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1825_RS24460 (P1825_24460) | 118380..119171 | + | 792 | WP_023994142.1 | F4 (K88) fimbria minor subunit FaeH | - |
| P1825_RS24465 (P1825_24465) | 119199..119963 | + | 765 | WP_023994141.1 | minor fimbrial protein | - |
| P1825_RS24470 (P1825_24470) | 120166..120756 | + | 591 | WP_023994140.1 | hypothetical protein | - |
| P1825_RS24475 (P1825_24475) | 120822..121034 | + | 213 | WP_023994139.1 | FaeA/PapI family transcriptional regulator | - |
| P1825_RS24480 (P1825_24480) | 121295..121456 | + | 162 | WP_001816720.1 | hypothetical protein | - |
| P1825_RS24485 (P1825_24485) | 121482..122330 | + | 849 | WP_023994138.1 | SdiA-regulated domain-containing protein | - |
| P1825_RS24490 (P1825_24490) | 122900..123316 | - | 417 | WP_023994137.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P1825_RS24495 (P1825_24495) | 123313..123543 | - | 231 | WP_023994136.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| P1825_RS24500 (P1825_24500) | 124167..124385 | + | 219 | WP_023994135.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| P1825_RS24505 (P1825_24505) | 124387..124692 | + | 306 | WP_023994134.1 | type II toxin-antitoxin system toxin CcdB | - |
| P1825_RS24510 (P1825_24510) | 124694..124984 | + | 291 | WP_023994133.1 | hypothetical protein | - |
| P1825_RS24515 (P1825_24515) | 124981..125256 | + | 276 | Protein_144 | 3'-5' exonuclease | - |
| P1825_RS24520 (P1825_24520) | 125327..125443 | + | 117 | Protein_145 | hypothetical protein | - |
| P1825_RS24525 (P1825_24525) | 125433..126148 | - | 716 | Protein_146 | transposase | - |
| P1825_RS24530 (P1825_24530) | 127430..127966 | + | 537 | WP_023994130.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA14 / ant(3'')-Ia / qacE / sul1 / tet(A) | faeC / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS | 1..285079 | 285079 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15123.58 Da Isoelectric Point: 8.5291
>T274698 WP_023994137.1 NZ_CP120328:c123316-122900 [Salmonella enterica subsp. enterica serovar Muenchen]
VKKMYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVNATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWGR
VKKMYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVNATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWGR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5T8FJ24 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5T3Q059 |