Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacT-ataR/DUF1778(antitoxin) |
| Location | 102880..103637 | Replicon | plasmid pESI |
| Accession | NZ_CP120328 | ||
| Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_10_2021 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A241PXX4 |
| Locus tag | P1825_RS24370 | Protein ID | WP_023994162.1 |
| Coordinates | 103155..103637 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A727Z1I8 |
| Locus tag | P1825_RS24365 | Protein ID | WP_001195098.1 |
| Coordinates | 102880..103164 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1825_RS24320 (P1825_24320) | 98721..98867 | - | 147 | Protein_105 | IS66 family insertion sequence element accessory protein TnpB | - |
| P1825_RS24325 (P1825_24325) | 98854..99183 | - | 330 | WP_023994169.1 | hypothetical protein | - |
| P1825_RS24330 (P1825_24330) | 99307..100160 | + | 854 | Protein_107 | site-specific tyrosine recombinase XerC | - |
| P1825_RS24335 (P1825_24335) | 100129..100416 | + | 288 | WP_031619580.1 | damage-inducible protein J | - |
| P1825_RS24340 (P1825_24340) | 100413..100718 | + | 306 | WP_023994167.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| P1825_RS24345 (P1825_24345) | 101468..101731 | + | 264 | WP_023994165.1 | DUF977 family protein | - |
| P1825_RS24350 (P1825_24350) | 101757..102092 | + | 336 | WP_023994164.1 | hypothetical protein | - |
| P1825_RS24355 (P1825_24355) | 102314..102511 | - | 198 | Protein_112 | PIN domain-containing protein | - |
| P1825_RS24360 (P1825_24360) | 102635..102724 | + | 90 | WP_071790431.1 | helix-turn-helix domain-containing protein | - |
| P1825_RS24365 (P1825_24365) | 102880..103164 | + | 285 | WP_001195098.1 | DUF1778 domain-containing protein | Antitoxin |
| P1825_RS24370 (P1825_24370) | 103155..103637 | + | 483 | WP_023994162.1 | GNAT family N-acetyltransferase | Toxin |
| P1825_RS24375 (P1825_24375) | 103952..104378 | + | 427 | Protein_116 | transposase | - |
| P1825_RS24380 (P1825_24380) | 104695..104904 | + | 210 | WP_023994160.1 | hemolysin expression modulator Hha | - |
| P1825_RS24385 (P1825_24385) | 104978..105330 | - | 353 | Protein_118 | transposase | - |
| P1825_RS24390 (P1825_24390) | 105558..106531 | + | 974 | Protein_119 | IS256 family transposase | - |
| P1825_RS24395 (P1825_24395) | 106533..106775 | + | 243 | WP_023994156.1 | hypothetical protein | - |
| P1825_RS24400 (P1825_24400) | 106846..107802 | + | 957 | WP_023994155.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| P1825_RS24405 (P1825_24405) | 107861..108073 | + | 213 | WP_023994154.1 | hypothetical protein | - |
| P1825_RS24410 (P1825_24410) | 108115..108366 | - | 252 | WP_023994153.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA14 / ant(3'')-Ia / qacE / sul1 / tet(A) | faeC / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS | 1..285079 | 285079 | |
| - | inside | IScluster/Tn | - | - | 97425..109930 | 12505 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17971.54 Da Isoelectric Point: 6.8521
>T274697 WP_023994162.1 NZ_CP120328:103155-103637 [Salmonella enterica subsp. enterica serovar Muenchen]
MEISVTAPELLNEEHYLQQFDCGNDVLSDWLRRRAMKNQYLNASRTFVICPEGTKRVVGYYSIATGSVSHASLGRSLRQN
MPDPVPVVLLGRLAVDECTQGHSFGKWLLNDAVTRVSNLADQVGIKAIMVHAIDEQAKTFYEYFGFVQSPIAPNTLFYKI
MEISVTAPELLNEEHYLQQFDCGNDVLSDWLRRRAMKNQYLNASRTFVICPEGTKRVVGYYSIATGSVSHASLGRSLRQN
MPDPVPVVLLGRLAVDECTQGHSFGKWLLNDAVTRVSNLADQVGIKAIMVHAIDEQAKTFYEYFGFVQSPIAPNTLFYKI
Download Length: 483 bp
Antitoxin
Download Length: 95 a.a. Molecular weight: 10964.52 Da Isoelectric Point: 9.6539
>AT274697 WP_001195098.1 NZ_CP120328:102880-103164 [Salmonella enterica subsp. enterica serovar Muenchen]
MQTTIRKSVRNKQINIRATDEERAVIDYAASLVSKNRTDFIIEKAVSEAQNIILDQRVFVLDDARYQAFIKQLEAPVQNT
EGRQRLMDVKPEWK
MQTTIRKSVRNKQINIRATDEERAVIDYAASLVSKNRTDFIIEKAVSEAQNIILDQRVFVLDDARYQAFIKQLEAPVQNT
EGRQRLMDVKPEWK
Download Length: 285 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A241PXX4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A727Z1I8 |