Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4304462..4305276 | Replicon | chromosome |
Accession | NZ_CP120327 | ||
Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_10_2021 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | P1825_RS21075 | Protein ID | WP_000971655.1 |
Coordinates | 4304749..4305276 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | P1825_RS21070 | Protein ID | WP_000855694.1 |
Coordinates | 4304462..4304752 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1825_RS21040 (4300390) | 4300390..4301040 | - | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
P1825_RS21045 (4301496) | 4301496..4301939 | + | 444 | WP_001522905.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
P1825_RS21050 (4302371) | 4302371..4302820 | + | 450 | WP_021294302.1 | hypothetical protein | - |
P1825_RS21055 (4302805) | 4302805..4303152 | + | 348 | WP_001669174.1 | DUF1493 family protein | - |
P1825_RS21060 (4303425) | 4303425..4303751 | - | 327 | WP_000393302.1 | hypothetical protein | - |
P1825_RS21065 (4303992) | 4303992..4304192 | + | 201 | Protein_4104 | transposase | - |
P1825_RS21070 (4304462) | 4304462..4304752 | + | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
P1825_RS21075 (4304749) | 4304749..4305276 | + | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
P1825_RS21080 (4305349) | 4305349..4305564 | - | 216 | Protein_4107 | IS5/IS1182 family transposase | - |
P1825_RS21085 (4305902) | 4305902..4306558 | + | 657 | WP_020437799.1 | protein-serine/threonine phosphatase | - |
P1825_RS21090 (4306803) | 4306803..4307297 | - | 495 | WP_000424942.1 | hypothetical protein | - |
P1825_RS21095 (4307324) | 4307324..4307992 | - | 669 | WP_000445914.1 | hypothetical protein | - |
P1825_RS21100 (4308149) | 4308149..4308388 | - | 240 | Protein_4111 | hypothetical protein | - |
P1825_RS21105 (4308579) | 4308579..4308976 | - | 398 | Protein_4112 | cytoplasmic protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 4305349..4305489 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T274694 WP_000971655.1 NZ_CP120327:4304749-4305276 [Salmonella enterica subsp. enterica serovar Muenchen]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.50 Da Isoelectric Point: 6.3133
>AT274694 WP_000855694.1 NZ_CP120327:4304462-4304752 [Salmonella enterica subsp. enterica serovar Muenchen]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |