Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1800288..1800908 | Replicon | chromosome |
| Accession | NZ_CP120327 | ||
| Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_10_2021 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | P1825_RS08470 | Protein ID | WP_001280991.1 |
| Coordinates | 1800288..1800506 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | P1825_RS08475 | Protein ID | WP_000344807.1 |
| Coordinates | 1800534..1800908 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1825_RS08430 (1795512) | 1795512..1796081 | + | 570 | WP_020437370.1 | YbaY family lipoprotein | - |
| P1825_RS08435 (1796114) | 1796114..1796503 | - | 390 | WP_000961285.1 | MGMT family protein | - |
| P1825_RS08445 (1796734) | 1796734..1798284 | - | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
| P1825_RS08450 (1798509) | 1798509..1798769 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| P1825_RS08455 (1798775) | 1798775..1798915 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| P1825_RS08460 (1798971) | 1798971..1799441 | - | 471 | WP_000136181.1 | YlaC family protein | - |
| P1825_RS08465 (1799558) | 1799558..1800109 | - | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
| P1825_RS08470 (1800288) | 1800288..1800506 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| P1825_RS08475 (1800534) | 1800534..1800908 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| P1825_RS08480 (1801404) | 1801404..1804553 | - | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| P1825_RS08485 (1804576) | 1804576..1805769 | - | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T274689 WP_001280991.1 NZ_CP120327:c1800506-1800288 [Salmonella enterica subsp. enterica serovar Muenchen]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT274689 WP_000344807.1 NZ_CP120327:c1800908-1800534 [Salmonella enterica subsp. enterica serovar Muenchen]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|