Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 153275..153861 Replicon chromosome
Accession NZ_CP120327
Organism Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_10_2021

Toxin (Protein)


Gene name doc Uniprot ID A0A0R9MYB2
Locus tag P1825_RS00780 Protein ID WP_000174966.1
Coordinates 153275..153643 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0R9PI96
Locus tag P1825_RS00785 Protein ID WP_001535398.1
Coordinates 153640..153861 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1825_RS00760 (148794) 148794..149864 - 1071 WP_000907842.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
P1825_RS00765 (149866) 149866..150711 - 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
P1825_RS00770 (150708) 150708..151595 - 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
P1825_RS00775 (151700) 151700..153016 - 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
P1825_RS00780 (153275) 153275..153643 - 369 WP_000174966.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
P1825_RS00785 (153640) 153640..153861 - 222 WP_001535398.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P1825_RS00790 (153993) 153993..154706 - 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
P1825_RS00795 (154708) 154708..155475 - 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
P1825_RS00800 (155472) 155472..156749 - 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
P1825_RS00805 (156746) 156746..157672 - 927 WP_000003005.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
P1825_RS00810 (157732) 157732..158841 - 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 148057..159645 11588


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13629.91 Da        Isoelectric Point: 6.4657

>T274682 WP_000174966.1 NZ_CP120327:c153643-153275 [Salmonella enterica subsp. enterica serovar Muenchen]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8165.23 Da        Isoelectric Point: 6.4643

>AT274682 WP_001535398.1 NZ_CP120327:c153861-153640 [Salmonella enterica subsp. enterica serovar Muenchen]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRKLADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0R9MYB2

Antitoxin

Source ID Structure
AlphaFold DB A0A0R9PI96

References