Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 28612..29134 Replicon plasmid p2
Accession NZ_CP120324
Organism Salmonella enterica subsp. enterica serovar Enteritidis strain PS_Ent_1_2022

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag P1705_RS23670 Protein ID WP_000220560.1
Coordinates 28853..29134 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag P1705_RS23665 Protein ID WP_000121743.1
Coordinates 28612..28863 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1705_RS23640 (24283) 24283..24564 + 282 WP_001185482.1 hypothetical protein -
P1705_RS23645 (24589) 24589..25566 + 978 WP_001269910.1 hypothetical protein -
P1705_RS23650 (25563) 25563..25919 - 357 WP_001426297.1 DNA distortion polypeptide 3 -
P1705_RS23655 (26056) 26056..26502 - 447 WP_024236382.1 hypothetical protein -
P1705_RS23660 (26542) 26542..27378 - 837 WP_001050931.1 RepB family plasmid replication initiator protein -
P1705_RS23665 (28612) 28612..28863 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
P1705_RS23670 (28853) 28853..29134 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P1705_RS23675 (29280) 29280..29603 + 324 WP_065622022.1 hypothetical protein -
P1705_RS23680 (29648) 29648..29893 + 246 WP_000356547.1 hypothetical protein -
P1705_RS23685 (29883) 29883..30098 + 216 WP_001180116.1 hypothetical protein -
P1705_RS23690 (30191) 30191..30520 + 330 WP_000866646.1 hypothetical protein -
P1705_RS23695 (30563) 30563..30742 + 180 WP_000439078.1 hypothetical protein -
P1705_RS23700 (30812) 30812..30961 + 150 WP_000003880.1 hypothetical protein -
P1705_RS23705 (30974) 30974..31246 + 273 WP_000160399.1 hypothetical protein -
P1705_RS23710 (31572) 31572..32117 + 546 WP_000757693.1 DNA distortion polypeptide 1 -
P1705_RS23715 (32120) 32120..33286 + 1167 WP_000539532.1 MobP1 family relaxase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..37699 37699


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T274663 WP_000220560.1 NZ_CP120324:28853-29134 [Salmonella enterica subsp. enterica serovar Enteritidis]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT274663 WP_000121743.1 NZ_CP120324:28612-28863 [Salmonella enterica subsp. enterica serovar Enteritidis]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References