Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 11391..11916 Replicon plasmid p1
Accession NZ_CP120323
Organism Salmonella enterica subsp. enterica serovar Enteritidis strain PS_Ent_1_2022

Toxin (Protein)


Gene name ccdB Uniprot ID I3W3D5
Locus tag P1705_RS23190 Protein ID WP_001159863.1
Coordinates 11611..11916 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7S5D0
Locus tag P1705_RS23185 Protein ID WP_000813641.1
Coordinates 11391..11609 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1705_RS23155 (P1705_23155) 7005..7391 + 387 WP_000751876.1 YgiW/YdeI family stress tolerance OB fold protein -
P1705_RS23160 (P1705_23160) 7444..7563 + 120 Protein_9 recombinase -
P1705_RS23165 (P1705_23165) 7932..8921 - 990 WP_000461382.1 RepB family plasmid replication initiator protein -
P1705_RS23170 (P1705_23170) 9415..9710 - 296 Protein_11 cytoplasmic protein -
P1705_RS23175 (P1705_23175) 9722..10150 + 429 Protein_12 hypothetical protein -
P1705_RS23180 (P1705_23180) 10194..10715 - 522 WP_077681952.1 hypothetical protein -
P1705_RS23185 (P1705_23185) 11391..11609 + 219 WP_000813641.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
P1705_RS23190 (P1705_23190) 11611..11916 + 306 WP_001159863.1 type II toxin-antitoxin system toxin CcdB Toxin
P1705_RS23195 (P1705_23195) 11918..12208 + 291 WP_025375060.1 hypothetical protein -
P1705_RS23200 (P1705_23200) 12205..12726 + 522 WP_065622004.1 cytoplasmic protein -
P1705_RS23205 (P1705_23205) 12761..13543 + 783 WP_000082169.1 site-specific integrase -
P1705_RS23210 (P1705_23210) 13552..14265 + 714 WP_000545756.1 EAL domain-containing protein -
P1705_RS23215 (P1705_23215) 14290..14778 + 489 WP_001075507.1 CaiF/GrlA family transcriptional regulator -
P1705_RS23220 (P1705_23220) 14772..15257 + 486 WP_000905606.1 membrane protein -
P1705_RS23225 (P1705_23225) 15534..15821 - 288 WP_071530243.1 hypothetical protein -
P1705_RS23230 (P1705_23230) 15977..16537 + 561 WP_000900095.1 inverse autotransporter beta domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - pefD / pefC / pefA / pefB / fdeC / spvC / spvB / rck 1..59372 59372


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11587.48 Da        Isoelectric Point: 6.9787

>T274662 WP_001159863.1 NZ_CP120323:11611-11916 [Salmonella enterica subsp. enterica serovar Enteritidis]
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8314.16 Da        Isoelectric Point: 4.5203

>AT274662 WP_000813641.1 NZ_CP120323:11391-11609 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQEENREGMAEVASFIEANGSFADDNRNW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB I3W3D5

Antitoxin

Source ID Structure
AlphaFold DB A0A656ICA6

References