Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4442010..4442596 Replicon chromosome
Accession NZ_CP120322
Organism Salmonella enterica subsp. enterica serovar Enteritidis strain PS_Ent_1_2022

Toxin (Protein)


Gene name doc Uniprot ID A0A3V9X0E4
Locus tag P1705_RS21840 Protein ID WP_000174964.1
Coordinates 4442010..4442378 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID V7IU48
Locus tag P1705_RS21845 Protein ID WP_001522145.1
Coordinates 4442375..4442596 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1705_RS21820 (4437528) 4437528..4438598 - 1071 WP_000907840.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
P1705_RS21825 (4438600) 4438600..4439446 - 847 Protein_4227 sn-glycerol-3-phosphate ABC transporter permease UgpE -
P1705_RS21830 (4439443) 4439443..4440330 - 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
P1705_RS21835 (4440435) 4440435..4441751 - 1317 WP_000624755.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
P1705_RS21840 (4442010) 4442010..4442378 - 369 WP_000174964.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
P1705_RS21845 (4442375) 4442375..4442596 - 222 WP_001522145.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P1705_RS21850 (4442727) 4442727..4443440 - 714 WP_065621995.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
P1705_RS21855 (4443442) 4443442..4444209 - 768 WP_000082080.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
P1705_RS21860 (4444206) 4444206..4445483 - 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
P1705_RS21865 (4445480) 4445480..4446406 - 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
P1705_RS21870 (4446466) 4446466..4447575 - 1110 WP_000822978.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4436791..4445483 8692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-114)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13601.91 Da        Isoelectric Point: 6.7252

>T274660 WP_000174964.1 NZ_CP120322:c4442378-4442010 [Salmonella enterica subsp. enterica serovar Enteritidis]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIVVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8166.17 Da        Isoelectric Point: 5.0775

>AT274660 WP_001522145.1 NZ_CP120322:c4442596-4442375 [Salmonella enterica subsp. enterica serovar Enteritidis]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3V9X0E4

Antitoxin

Source ID Structure

References