Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1306452..1307072 | Replicon | chromosome |
| Accession | NZ_CP120322 | ||
| Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain PS_Ent_1_2022 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | P1705_RS06190 | Protein ID | WP_001280991.1 |
| Coordinates | 1306452..1306670 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | P1705_RS06195 | Protein ID | WP_000344807.1 |
| Coordinates | 1306698..1307072 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1705_RS06150 (1301675) | 1301675..1302244 | + | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
| P1705_RS06155 (1302277) | 1302277..1302666 | - | 390 | WP_000961287.1 | MGMT family protein | - |
| P1705_RS06165 (1302897) | 1302897..1304447 | - | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
| P1705_RS06170 (1304672) | 1304672..1304932 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| P1705_RS06175 (1304938) | 1304938..1305078 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| P1705_RS06180 (1305134) | 1305134..1305604 | - | 471 | WP_000136183.1 | YlaC family protein | - |
| P1705_RS06185 (1305722) | 1305722..1306273 | - | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| P1705_RS06190 (1306452) | 1306452..1306670 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| P1705_RS06195 (1306698) | 1306698..1307072 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| P1705_RS06200 (1307568) | 1307568..1310717 | - | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| P1705_RS06205 (1310740) | 1310740..1311933 | - | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T274650 WP_001280991.1 NZ_CP120322:c1306670-1306452 [Salmonella enterica subsp. enterica serovar Enteritidis]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT274650 WP_000344807.1 NZ_CP120322:c1307072-1306698 [Salmonella enterica subsp. enterica serovar Enteritidis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|