Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 680705..681255 Replicon chromosome
Accession NZ_CP120322
Organism Salmonella enterica subsp. enterica serovar Enteritidis strain PS_Ent_1_2022

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag P1705_RS03305 Protein ID WP_001199743.1
Coordinates 680947..681255 (+) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7RP97
Locus tag P1705_RS03300 Protein ID WP_001118105.1
Coordinates 680705..680944 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1705_RS03270 (676144) 676144..677175 - 1032 WP_000453347.1 L-idonate 5-dehydrogenase -
P1705_RS03275 (677392) 677392..677922 + 531 WP_000896758.1 gluconokinase -
P1705_RS03280 (677950) 677950..678969 - 1020 WP_000152558.1 NAD(P)-dependent alcohol dehydrogenase -
P1705_RS03290 (679726) 679726..680271 + 546 WP_223151225.1 helix-turn-helix domain-containing protein -
P1705_RS03295 (680348) 680348..680596 + 249 WP_000168388.1 ribbon-helix-helix domain-containing protein -
P1705_RS03300 (680705) 680705..680944 + 240 WP_001118105.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
P1705_RS03305 (680947) 680947..681255 + 309 WP_001199743.1 CcdB family protein Toxin
P1705_RS03310 (681661) 681661..681801 + 141 Protein_610 Arm DNA-binding domain-containing protein -
P1705_RS03315 (681833) 681833..682966 - 1134 Protein_611 IS3 family transposase -
P1705_RS03320 (683289) 683289..683819 + 531 WP_001708209.1 SEF14 fimbria major subunit SefA -
P1705_RS03325 (683941) 683941..684681 + 741 WP_001676217.1 SEF14/SEF18 fimbria chaperone SefB -
P1705_RS03330 (684698) 684698..686158 + 1461 WP_283903124.1 fimbria/pilus outer membrane usher protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 679771..682874 3103


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T274646 WP_001199743.1 NZ_CP120322:680947-681255 [Salmonella enterica subsp. enterica serovar Enteritidis]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8719.90 Da        Isoelectric Point: 6.4633

>AT274646 WP_001118105.1 NZ_CP120322:680705-680944 [Salmonella enterica subsp. enterica serovar Enteritidis]
MPGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5H9SZK8

References