Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 680705..681255 | Replicon | chromosome |
| Accession | NZ_CP120322 | ||
| Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain PS_Ent_1_2022 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | M7RJ32 |
| Locus tag | P1705_RS03305 | Protein ID | WP_001199743.1 |
| Coordinates | 680947..681255 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | M7RP97 |
| Locus tag | P1705_RS03300 | Protein ID | WP_001118105.1 |
| Coordinates | 680705..680944 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1705_RS03270 (676144) | 676144..677175 | - | 1032 | WP_000453347.1 | L-idonate 5-dehydrogenase | - |
| P1705_RS03275 (677392) | 677392..677922 | + | 531 | WP_000896758.1 | gluconokinase | - |
| P1705_RS03280 (677950) | 677950..678969 | - | 1020 | WP_000152558.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| P1705_RS03290 (679726) | 679726..680271 | + | 546 | WP_223151225.1 | helix-turn-helix domain-containing protein | - |
| P1705_RS03295 (680348) | 680348..680596 | + | 249 | WP_000168388.1 | ribbon-helix-helix domain-containing protein | - |
| P1705_RS03300 (680705) | 680705..680944 | + | 240 | WP_001118105.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| P1705_RS03305 (680947) | 680947..681255 | + | 309 | WP_001199743.1 | CcdB family protein | Toxin |
| P1705_RS03310 (681661) | 681661..681801 | + | 141 | Protein_610 | Arm DNA-binding domain-containing protein | - |
| P1705_RS03315 (681833) | 681833..682966 | - | 1134 | Protein_611 | IS3 family transposase | - |
| P1705_RS03320 (683289) | 683289..683819 | + | 531 | WP_001708209.1 | SEF14 fimbria major subunit SefA | - |
| P1705_RS03325 (683941) | 683941..684681 | + | 741 | WP_001676217.1 | SEF14/SEF18 fimbria chaperone SefB | - |
| P1705_RS03330 (684698) | 684698..686158 | + | 1461 | WP_283903124.1 | fimbria/pilus outer membrane usher protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 679771..682874 | 3103 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T274646 WP_001199743.1 NZ_CP120322:680947-681255 [Salmonella enterica subsp. enterica serovar Enteritidis]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H9SZK8 |