Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 639614..640130 | Replicon | chromosome |
Accession | NZ_CP120322 | ||
Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain PS_Ent_1_2022 |
Toxin (Protein)
Gene name | relE | Uniprot ID | B5R9I9 |
Locus tag | P1705_RS03100 | Protein ID | WP_000220582.1 |
Coordinates | 639846..640130 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | P1705_RS03095 | Protein ID | WP_000212724.1 |
Coordinates | 639614..639856 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1705_RS03075 (634635) | 634635..635768 | + | 1134 | WP_000459957.1 | amidohydrolase/deacetylase family metallohydrolase | - |
P1705_RS03080 (635752) | 635752..636870 | + | 1119 | WP_001139169.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
P1705_RS03085 (636867) | 636867..637606 | + | 740 | Protein_566 | KDGP aldolase family protein | - |
P1705_RS03090 (637623) | 637623..639536 | + | 1914 | WP_001212142.1 | BglG family transcription antiterminator | - |
P1705_RS03095 (639614) | 639614..639856 | + | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
P1705_RS03100 (639846) | 639846..640130 | + | 285 | WP_000220582.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P1705_RS03105 (640134) | 640134..640598 | - | 465 | WP_001268859.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
P1705_RS03110 (640720) | 640720..642858 | - | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
P1705_RS03115 (643267) | 643267..644919 | - | 1653 | WP_000155048.1 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10912.66 Da Isoelectric Point: 9.6743
>T274645 WP_000220582.1 NZ_CP120322:639846-640130 [Salmonella enterica subsp. enterica serovar Enteritidis]
MTYELEFDPRALKEWHKLGDTVQAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVQAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A656ILJ8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |