Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 532453..533234 | Replicon | chromosome |
Accession | NZ_CP120322 | ||
Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain PS_Ent_1_2022 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | B5R980 |
Locus tag | P1705_RS02525 | Protein ID | WP_000626100.1 |
Coordinates | 532743..533234 (+) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | P1705_RS02520 | Protein ID | WP_001110452.1 |
Coordinates | 532453..532746 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1705_RS02485 (528500) | 528500..529405 | + | 906 | WP_001268200.1 | YjiK family protein | - |
P1705_RS02490 (529699) | 529699..529830 | - | 132 | Protein_451 | hypothetical protein | - |
P1705_RS02495 (529942) | 529942..530190 | - | 249 | Protein_452 | Ig-like domain-containing protein | - |
P1705_RS02500 (530315) | 530315..530497 | + | 183 | WP_001676222.1 | ATP-binding cassette domain-containing protein | - |
P1705_RS02505 (530490) | 530490..530777 | - | 288 | WP_001541332.1 | transcriptional regulator RtsB | - |
P1705_RS02510 (530774) | 530774..531649 | - | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
P1705_RS02515 (531915) | 531915..532136 | - | 222 | WP_001576552.1 | hypothetical protein | - |
P1705_RS02520 (532453) | 532453..532746 | + | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
P1705_RS02525 (532743) | 532743..533234 | + | 492 | WP_000626100.1 | GNAT family N-acetyltransferase | Toxin |
P1705_RS02530 (533482) | 533482..534234 | - | 753 | WP_283903117.1 | non-specific acid phosphatase | - |
P1705_RS02535 (534334) | 534334..534411 | - | 78 | Protein_460 | porin family protein | - |
P1705_RS02540 (534791) | 534791..534865 | + | 75 | Protein_461 | helix-turn-helix domain-containing protein | - |
P1705_RS02550 (535136) | 535136..535711 | - | 576 | WP_001188509.1 | transcriptional regulator | - |
P1705_RS02555 (535748) | 535748..537451 | - | 1704 | WP_000068885.1 | protein-disulfide reductase DsbD | - |
P1705_RS02560 (537427) | 537427..537774 | - | 348 | WP_000887832.1 | divalent cation tolerance protein CutA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17645.45 Da Isoelectric Point: 7.7297
>T274644 WP_000626100.1 NZ_CP120322:532743-533234 [Salmonella enterica subsp. enterica serovar Enteritidis]
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10977.61 Da Isoelectric Point: 8.6141
>AT274644 WP_001110452.1 NZ_CP120322:532453-532746 [Salmonella enterica subsp. enterica serovar Enteritidis]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A656IQ80 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 | |
AlphaFold DB | A0A5I1DGA4 |