Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4071615..4072165 Replicon chromosome
Accession NZ_CP120318
Organism Salmonella enterica subsp. enterica serovar Enteritidis strain PS_Ent_2_2022

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag P1703_RS19945 Protein ID WP_001199743.1
Coordinates 4071615..4071923 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7RP97
Locus tag P1703_RS19950 Protein ID WP_001118105.1
Coordinates 4071926..4072165 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1703_RS19925 (4068188) 4068188..4068928 - 741 WP_001676217.1 SEF14/SEF18 fimbria chaperone SefB -
P1703_RS19930 (4069050) 4069050..4069580 - 531 WP_001708209.1 SEF14 fimbria major subunit SefA -
P1703_RS19935 (4069903) 4069903..4071036 + 1134 Protein_3896 IS3 family transposase -
P1703_RS19940 (4071068) 4071068..4071208 - 141 Protein_3897 Arm DNA-binding domain-containing protein -
P1703_RS19945 (4071615) 4071615..4071923 - 309 WP_001199743.1 CcdB family protein Toxin
P1703_RS19950 (4071926) 4071926..4072165 - 240 WP_001118105.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
P1703_RS19955 (4072274) 4072274..4072522 - 249 WP_000168388.1 ribbon-helix-helix domain-containing protein -
P1703_RS19960 (4072713) 4072713..4073144 - 432 Protein_3901 helix-turn-helix domain-containing protein -
P1703_RS19970 (4073901) 4073901..4074920 + 1020 WP_000152558.1 NAD(P)-dependent alcohol dehydrogenase -
P1703_RS19975 (4074948) 4074948..4075478 - 531 WP_000896758.1 gluconokinase -
P1703_RS19980 (4075695) 4075695..4076726 + 1032 WP_000453347.1 L-idonate 5-dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 4069995..4073099 3104


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T274636 WP_001199743.1 NZ_CP120318:c4071923-4071615 [Salmonella enterica subsp. enterica serovar Enteritidis]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8719.90 Da        Isoelectric Point: 6.4633

>AT274636 WP_001118105.1 NZ_CP120318:c4072165-4071926 [Salmonella enterica subsp. enterica serovar Enteritidis]
MPGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5H9SZK8

References