Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3445804..3446424 | Replicon | chromosome |
| Accession | NZ_CP120318 | ||
| Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain PS_Ent_2_2022 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | P1703_RS17065 | Protein ID | WP_001280991.1 |
| Coordinates | 3446206..3446424 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | P1703_RS17060 | Protein ID | WP_000344807.1 |
| Coordinates | 3445804..3446178 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1703_RS17050 (3440943) | 3440943..3442136 | + | 1194 | WP_283902913.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| P1703_RS17055 (3442159) | 3442159..3445308 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| P1703_RS17060 (3445804) | 3445804..3446178 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| P1703_RS17065 (3446206) | 3446206..3446424 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| P1703_RS17070 (3446603) | 3446603..3447154 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| P1703_RS17075 (3447272) | 3447272..3447742 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| P1703_RS17080 (3447798) | 3447798..3447938 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| P1703_RS17085 (3447944) | 3447944..3448204 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| P1703_RS17090 (3448429) | 3448429..3449979 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
| P1703_RS17100 (3450210) | 3450210..3450599 | + | 390 | WP_000961287.1 | MGMT family protein | - |
| P1703_RS17105 (3450632) | 3450632..3451201 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T274632 WP_001280991.1 NZ_CP120318:3446206-3446424 [Salmonella enterica subsp. enterica serovar Enteritidis]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT274632 WP_000344807.1 NZ_CP120318:3445804-3446178 [Salmonella enterica subsp. enterica serovar Enteritidis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|