Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 310308..310894 Replicon chromosome
Accession NZ_CP120318
Organism Salmonella enterica subsp. enterica serovar Enteritidis strain PS_Ent_2_2022

Toxin (Protein)


Gene name doc Uniprot ID A0A3V9X0E4
Locus tag P1703_RS01415 Protein ID WP_000174964.1
Coordinates 310526..310894 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID V7IU48
Locus tag P1703_RS01410 Protein ID WP_001522145.1
Coordinates 310308..310529 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1703_RS01385 (305329) 305329..306438 + 1110 WP_000822978.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
P1703_RS01390 (306498) 306498..307424 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
P1703_RS01395 (307421) 307421..308698 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
P1703_RS01400 (308695) 308695..309462 + 768 WP_000082080.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
P1703_RS01405 (309464) 309464..310177 + 714 WP_065621995.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
P1703_RS01410 (310308) 310308..310529 + 222 WP_001522145.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P1703_RS01415 (310526) 310526..310894 + 369 WP_000174964.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
P1703_RS01420 (311153) 311153..312469 + 1317 WP_000624755.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
P1703_RS01425 (312574) 312574..313461 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
P1703_RS01430 (313458) 313458..314303 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
P1703_RS01435 (314305) 314305..315375 + 1071 WP_000907840.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 307421..316112 8691


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-114)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13601.91 Da        Isoelectric Point: 6.7252

>T274622 WP_000174964.1 NZ_CP120318:310526-310894 [Salmonella enterica subsp. enterica serovar Enteritidis]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIVVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8166.17 Da        Isoelectric Point: 5.0775

>AT274622 WP_001522145.1 NZ_CP120318:310308-310529 [Salmonella enterica subsp. enterica serovar Enteritidis]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3V9X0E4

Antitoxin

Source ID Structure

References