Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 123322..123998 | Replicon | plasmid pTiCFBP4996 |
Accession | NZ_CP120216 | ||
Organism | Agrobacterium leguminum strain CFBP4996 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | CFBP4996_RS27275 | Protein ID | WP_080855069.1 |
Coordinates | 123576..123998 (+) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | CFBP4996_RS27270 | Protein ID | WP_080855068.1 |
Coordinates | 123322..123579 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFBP4996_RS27260 (CFBP4996_27260) | 121612..121959 | - | 348 | WP_080855066.1 | hypothetical protein | - |
CFBP4996_RS27265 (CFBP4996_27265) | 122392..122706 | - | 315 | WP_080855067.1 | helix-turn-helix transcriptional regulator | - |
CFBP4996_RS27270 (CFBP4996_27270) | 123322..123579 | + | 258 | WP_080855068.1 | Arc family DNA-binding protein | Antitoxin |
CFBP4996_RS27275 (CFBP4996_27275) | 123576..123998 | + | 423 | WP_080855069.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
CFBP4996_RS27280 (CFBP4996_27280) | 124079..124999 | - | 921 | WP_080855070.1 | LysR family transcriptional regulator | - |
CFBP4996_RS27285 (CFBP4996_27285) | 125258..126172 | + | 915 | WP_080855393.1 | nucleotidyltransferase and HEPN domain-containing protein | - |
CFBP4996_RS27290 (CFBP4996_27290) | 126239..126405 | + | 167 | Protein_130 | transposase | - |
CFBP4996_RS27295 (CFBP4996_27295) | 126467..127639 | - | 1173 | WP_080855072.1 | Fic family protein | - |
CFBP4996_RS27300 (CFBP4996_27300) | 127850..128611 | - | 762 | WP_233283475.1 | autoinducer binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..605495 | 605495 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15518.95 Da Isoelectric Point: 4.9008
>T274597 WP_080855069.1 NZ_CP120216:123576-123998 [Agrobacterium leguminum]
MIVLDTNVISELWKVEPDSSVLTWIDSQMVETLYLSTITIAELRFGLATMPEGKRRTIYQDRLEREVLPVFTGRILFFDL
DASQAYAQLMARAKEAGRAIGKADGYIAAAAAVRGLIVATRDTSPFEAAGLRVINPWNVV
MIVLDTNVISELWKVEPDSSVLTWIDSQMVETLYLSTITIAELRFGLATMPEGKRRTIYQDRLEREVLPVFTGRILFFDL
DASQAYAQLMARAKEAGRAIGKADGYIAAAAAVRGLIVATRDTSPFEAAGLRVINPWNVV
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|