Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 108329..108993 | Replicon | plasmid pTiCFBP4996 |
| Accession | NZ_CP120216 | ||
| Organism | Agrobacterium leguminum strain CFBP4996 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | CFBP4996_RS27180 | Protein ID | WP_080855052.1 |
| Coordinates | 108329..108736 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | CFBP4996_RS27185 | Protein ID | WP_080855053.1 |
| Coordinates | 108733..108993 (-) | Length | 87 a.a. |
Genomic Context
Location: 105043..106104 (1062 bp)
Type: Others
Protein ID: WP_080855049.1
Type: Others
Protein ID: WP_080855049.1
Location: 106490..107431 (942 bp)
Type: Others
Protein ID: WP_080855050.1
Type: Others
Protein ID: WP_080855050.1
Location: 107628..108326 (699 bp)
Type: Others
Protein ID: WP_137396200.1
Type: Others
Protein ID: WP_137396200.1
Location: 109211..109477 (267 bp)
Type: Others
Protein ID: WP_080855054.1
Type: Others
Protein ID: WP_080855054.1
Location: 109646..109912 (267 bp)
Type: Others
Protein ID: WP_080855055.1
Type: Others
Protein ID: WP_080855055.1
Location: 109909..110306 (398 bp)
Type: Others
Protein ID: Protein_112
Type: Others
Protein ID: Protein_112
Location: 110925..111248 (324 bp)
Type: Others
Protein ID: WP_080855056.1
Type: Others
Protein ID: WP_080855056.1
Location: 111596..111760 (165 bp)
Type: Others
Protein ID: WP_162936144.1
Type: Others
Protein ID: WP_162936144.1
Location: 111889..112158 (270 bp)
Type: Others
Protein ID: WP_080855057.1
Type: Others
Protein ID: WP_080855057.1
Location: 112155..112568 (414 bp)
Type: Others
Protein ID: WP_080855058.1
Type: Others
Protein ID: WP_080855058.1
Location: 113351..113746 (396 bp)
Type: Others
Protein ID: WP_080855061.1
Type: Others
Protein ID: WP_080855061.1
Location: 106105..106491 (387 bp)
Type: Others
Protein ID: WP_170988534.1
Type: Others
Protein ID: WP_170988534.1
Location: 108329..108736 (408 bp)
Type: Toxin
Protein ID: WP_080855052.1
Type: Toxin
Protein ID: WP_080855052.1
Location: 108733..108993 (261 bp)
Type: Antitoxin
Protein ID: WP_080855053.1
Type: Antitoxin
Protein ID: WP_080855053.1
Location: 112552..112815 (264 bp)
Type: Others
Protein ID: WP_080855059.1
Type: Others
Protein ID: WP_080855059.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CFBP4996_RS27160 (CFBP4996_27160) | 105043..106104 | + | 1062 | WP_080855049.1 | toprim domain-containing protein | - |
| CFBP4996_RS27165 (CFBP4996_27165) | 106105..106491 | - | 387 | WP_170988534.1 | hypothetical protein | - |
| CFBP4996_RS27170 (CFBP4996_27170) | 106490..107431 | + | 942 | WP_080855050.1 | DUF2493 domain-containing protein | - |
| CFBP4996_RS27175 (CFBP4996_27175) | 107628..108326 | + | 699 | WP_137396200.1 | hypothetical protein | - |
| CFBP4996_RS27180 (CFBP4996_27180) | 108329..108736 | - | 408 | WP_080855052.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| CFBP4996_RS27185 (CFBP4996_27185) | 108733..108993 | - | 261 | WP_080855053.1 | antitoxin | Antitoxin |
| CFBP4996_RS27190 (CFBP4996_27190) | 109211..109477 | + | 267 | WP_080855054.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| CFBP4996_RS27195 (CFBP4996_27195) | 109646..109912 | + | 267 | WP_080855055.1 | antitoxin of toxin-antitoxin stability system | - |
| CFBP4996_RS27200 (CFBP4996_27200) | 109909..110306 | + | 398 | Protein_112 | type II toxin-antitoxin system VapC family toxin | - |
| CFBP4996_RS27205 (CFBP4996_27205) | 110925..111248 | + | 324 | WP_080855056.1 | DUF736 family protein | - |
| CFBP4996_RS27210 (CFBP4996_27210) | 111596..111760 | + | 165 | WP_162936144.1 | hypothetical protein | - |
| CFBP4996_RS27215 (CFBP4996_27215) | 111889..112158 | + | 270 | WP_080855057.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| CFBP4996_RS27220 (CFBP4996_27220) | 112155..112568 | + | 414 | WP_080855058.1 | hypothetical protein | - |
| CFBP4996_RS27225 (CFBP4996_27225) | 112552..112815 | - | 264 | WP_080855059.1 | WGR domain-containing protein | - |
| CFBP4996_RS27230 (CFBP4996_27230) | 113351..113746 | + | 396 | WP_080855061.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..605495 | 605495 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14700.91 Da Isoelectric Point: 5.6327
>T274596 WP_080855052.1 NZ_CP120216:c108736-108329 [Agrobacterium leguminum]
VISHLLDTNAVIALIGRRSDMLVNRVLQSAEGTIGLPSIVAHELYFGAQKSAKVQHNLETLRLVFADFPVLDFDQRDAFV
AGEIRAALAAKGMPIGPYDVLIAGQAKARGLMLVTNNLGEFNRVDGLRVEDWSTE
VISHLLDTNAVIALIGRRSDMLVNRVLQSAEGTIGLPSIVAHELYFGAQKSAKVQHNLETLRLVFADFPVLDFDQRDAFV
AGEIRAALAAKGMPIGPYDVLIAGQAKARGLMLVTNNLGEFNRVDGLRVEDWSTE
Download Length: 408 bp