Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 108329..108993 Replicon plasmid pTiCFBP4996
Accession NZ_CP120216
Organism Agrobacterium leguminum strain CFBP4996

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag CFBP4996_RS27180 Protein ID WP_080855052.1
Coordinates 108329..108736 (-) Length 136 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag CFBP4996_RS27185 Protein ID WP_080855053.1
Coordinates 108733..108993 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CFBP4996_RS27160 (CFBP4996_27160) 105043..106104 + 1062 WP_080855049.1 toprim domain-containing protein -
CFBP4996_RS27165 (CFBP4996_27165) 106105..106491 - 387 WP_170988534.1 hypothetical protein -
CFBP4996_RS27170 (CFBP4996_27170) 106490..107431 + 942 WP_080855050.1 DUF2493 domain-containing protein -
CFBP4996_RS27175 (CFBP4996_27175) 107628..108326 + 699 WP_137396200.1 hypothetical protein -
CFBP4996_RS27180 (CFBP4996_27180) 108329..108736 - 408 WP_080855052.1 type II toxin-antitoxin system VapC family toxin Toxin
CFBP4996_RS27185 (CFBP4996_27185) 108733..108993 - 261 WP_080855053.1 antitoxin Antitoxin
CFBP4996_RS27190 (CFBP4996_27190) 109211..109477 + 267 WP_080855054.1 type II toxin-antitoxin system ParD family antitoxin -
CFBP4996_RS27195 (CFBP4996_27195) 109646..109912 + 267 WP_080855055.1 antitoxin of toxin-antitoxin stability system -
CFBP4996_RS27200 (CFBP4996_27200) 109909..110306 + 398 Protein_112 type II toxin-antitoxin system VapC family toxin -
CFBP4996_RS27205 (CFBP4996_27205) 110925..111248 + 324 WP_080855056.1 DUF736 family protein -
CFBP4996_RS27210 (CFBP4996_27210) 111596..111760 + 165 WP_162936144.1 hypothetical protein -
CFBP4996_RS27215 (CFBP4996_27215) 111889..112158 + 270 WP_080855057.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
CFBP4996_RS27220 (CFBP4996_27220) 112155..112568 + 414 WP_080855058.1 hypothetical protein -
CFBP4996_RS27225 (CFBP4996_27225) 112552..112815 - 264 WP_080855059.1 WGR domain-containing protein -
CFBP4996_RS27230 (CFBP4996_27230) 113351..113746 + 396 WP_080855061.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..605495 605495


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-126)

Antitoxin

SpoVT-AbrB domain

(8-57)


Sequences

Toxin        


Download         Length: 136 a.a.        Molecular weight: 14700.91 Da        Isoelectric Point: 5.6327

>T274596 WP_080855052.1 NZ_CP120216:c108736-108329 [Agrobacterium leguminum]
VISHLLDTNAVIALIGRRSDMLVNRVLQSAEGTIGLPSIVAHELYFGAQKSAKVQHNLETLRLVFADFPVLDFDQRDAFV
AGEIRAALAAKGMPIGPYDVLIAGQAKARGLMLVTNNLGEFNRVDGLRVEDWSTE

Download         Length: 408 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9690.92 Da        Isoelectric Point: 6.4669

>AT274596 WP_080855053.1 NZ_CP120216:c108993-108733 [Agrobacterium leguminum]
MPHVARVFQSGNSQAVRLPKEFRFDVDRVDITQEGDALVLRPHVERGDAWSSLKAAMARGVSDDFMKGGREQPKPQDRPE
LDTVFP

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References