Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RelB |
| Location | 52702..53300 | Replicon | plasmid pTiCFBP4996 |
| Accession | NZ_CP120216 | ||
| Organism | Agrobacterium leguminum strain CFBP4996 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | CFBP4996_RS26915 | Protein ID | WP_078053756.1 |
| Coordinates | 53007..53300 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | CFBP4996_RS26910 | Protein ID | WP_078053757.1 |
| Coordinates | 52702..53010 (+) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CFBP4996_RS26880 (CFBP4996_26880) | 47961..48344 | + | 384 | WP_223565060.1 | transposase | - |
| CFBP4996_RS26885 (CFBP4996_26885) | 48269..48904 | + | 636 | WP_223565061.1 | IS630 family transposase | - |
| CFBP4996_RS26890 (CFBP4996_26890) | 49412..49885 | + | 474 | WP_078053760.1 | Hsp20 family protein | - |
| CFBP4996_RS26895 (CFBP4996_26895) | 49963..50262 | + | 300 | WP_078053759.1 | DUF982 domain-containing protein | - |
| CFBP4996_RS26900 (CFBP4996_26900) | 50492..50998 | - | 507 | WP_112967606.1 | IS3 family transposase | - |
| CFBP4996_RS26905 (CFBP4996_26905) | 51661..51780 | - | 120 | Protein_53 | nitroreductase family protein | - |
| CFBP4996_RS26910 (CFBP4996_26910) | 52702..53010 | + | 309 | WP_078053757.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| CFBP4996_RS26915 (CFBP4996_26915) | 53007..53300 | + | 294 | WP_078053756.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
| CFBP4996_RS26920 (CFBP4996_26920) | 53572..56679 | - | 3108 | WP_245311001.1 | autotransporter outer membrane beta-barrel domain-containing protein | - |
| CFBP4996_RS26925 (CFBP4996_26925) | 57492..57734 | + | 243 | WP_078053834.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..605495 | 605495 | |
| - | flank | IS/Tn | - | - | 48317..48904 | 587 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10746.27 Da Isoelectric Point: 5.7995
>T274595 WP_078053756.1 NZ_CP120216:53007-53300 [Agrobacterium leguminum]
VKLTWSAFALSDRDAIFTYIEADNPAAAILIDERIVSAARRLLDFPASGRLGRIAGTRELVINGTPYVAAYATTETTVRI
LRVLHGAQEWPEYLLQN
VKLTWSAFALSDRDAIFTYIEADNPAAAILIDERIVSAARRLLDFPASGRLGRIAGTRELVINGTPYVAAYATTETTVRI
LRVLHGAQEWPEYLLQN
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|