Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-DUF971 |
Location | 2191858..2192443 | Replicon | chromosome |
Accession | NZ_CP120212 | ||
Organism | Agrobacterium leguminum strain CFBP4996 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | CFBP4996_RS24535 | Protein ID | WP_080853461.1 |
Coordinates | 2192141..2192443 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A546W9H2 |
Locus tag | CFBP4996_RS24530 | Protein ID | WP_003521755.1 |
Coordinates | 2191858..2192148 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFBP4996_RS24510 (CFBP4996_24510) | 2187958..2188968 | + | 1011 | WP_080853465.1 | iron-siderophore ABC transporter substrate-binding protein | - |
CFBP4996_RS24515 (CFBP4996_24515) | 2188965..2190008 | + | 1044 | WP_080853464.1 | iron ABC transporter permease | - |
CFBP4996_RS24520 (CFBP4996_24520) | 2190005..2191045 | + | 1041 | WP_080853463.1 | iron chelate uptake ABC transporter family permease subunit | - |
CFBP4996_RS24525 (CFBP4996_24525) | 2191042..2191857 | + | 816 | WP_080853462.1 | ABC transporter ATP-binding protein | - |
CFBP4996_RS24530 (CFBP4996_24530) | 2191858..2192148 | - | 291 | WP_003521755.1 | putative addiction module antidote protein | Antitoxin |
CFBP4996_RS24535 (CFBP4996_24535) | 2192141..2192443 | - | 303 | WP_080853461.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CFBP4996_RS24540 (CFBP4996_24540) | 2192605..2193477 | - | 873 | WP_080853460.1 | helix-turn-helix transcriptional regulator | - |
CFBP4996_RS24545 (CFBP4996_24545) | 2193612..2194826 | + | 1215 | WP_080853459.1 | amino acid ABC transporter substrate-binding protein | - |
CFBP4996_RS24550 (CFBP4996_24550) | 2194897..2195769 | + | 873 | WP_080853458.1 | branched-chain amino acid ABC transporter permease | - |
CFBP4996_RS24555 (CFBP4996_24555) | 2195766..2196674 | + | 909 | WP_003521750.1 | branched-chain amino acid ABC transporter permease | - |
CFBP4996_RS24560 (CFBP4996_24560) | 2196671..2197399 | + | 729 | WP_080853457.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11084.59 Da Isoelectric Point: 8.9323
>T274594 WP_080853461.1 NZ_CP120212:c2192443-2192141 [Agrobacterium leguminum]
MQLKQSATFQKWFGKLKDERGKALITSRLNRLSFGHAGDVAPVGEGVSELRIHYGPGYRIYFVRSGDVVIVLLCGGDKST
QEKDIKAAKQIAAQWSDDDD
MQLKQSATFQKWFGKLKDERGKALITSRLNRLSFGHAGDVAPVGEGVSELRIHYGPGYRIYFVRSGDVVIVLLCGGDKST
QEKDIKAAKQIAAQWSDDDD
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|