Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
Location | 1195169..1195718 | Replicon | chromosome |
Accession | NZ_CP120211 | ||
Organism | Agrobacterium leguminum strain CFBP4996 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | CFBP4996_RS05930 | Protein ID | WP_080852022.1 |
Coordinates | 1195169..1195459 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | CFBP4996_RS05935 | Protein ID | WP_080852020.1 |
Coordinates | 1195452..1195718 (-) | Length | 89 a.a. |
Genomic Context
Location: 1193181..1193810 (630 bp)
Type: Others
Protein ID: WP_003525062.1
Type: Others
Protein ID: WP_003525062.1
Location: 1193943..1195091 (1149 bp)
Type: Others
Protein ID: WP_080852024.1
Type: Others
Protein ID: WP_080852024.1
Location: 1196652..1199573 (2922 bp)
Type: Others
Protein ID: WP_003525047.1
Type: Others
Protein ID: WP_003525047.1
Location: 1199630..1200430 (801 bp)
Type: Others
Protein ID: WP_080852018.1
Type: Others
Protein ID: WP_080852018.1
Location: 1190171..1192963 (2793 bp)
Type: Others
Protein ID: WP_080852025.1
Type: Others
Protein ID: WP_080852025.1
Location: 1195169..1195459 (291 bp)
Type: Toxin
Protein ID: WP_080852022.1
Type: Toxin
Protein ID: WP_080852022.1
Location: 1195452..1195718 (267 bp)
Type: Antitoxin
Protein ID: WP_080852020.1
Type: Antitoxin
Protein ID: WP_080852020.1
Location: 1195812..1196387 (576 bp)
Type: Others
Protein ID: WP_065655441.1
Type: Others
Protein ID: WP_065655441.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFBP4996_RS05915 (CFBP4996_05915) | 1190171..1192963 | - | 2793 | WP_080852025.1 | DNA gyrase subunit A | - |
CFBP4996_RS05920 (CFBP4996_05920) | 1193181..1193810 | + | 630 | WP_003525062.1 | MarC family protein | - |
CFBP4996_RS05925 (CFBP4996_05925) | 1193943..1195091 | + | 1149 | WP_080852024.1 | HPP family protein | - |
CFBP4996_RS05930 (CFBP4996_05930) | 1195169..1195459 | - | 291 | WP_080852022.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CFBP4996_RS05935 (CFBP4996_05935) | 1195452..1195718 | - | 267 | WP_080852020.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
CFBP4996_RS05940 (CFBP4996_05940) | 1195812..1196387 | - | 576 | WP_065655441.1 | single-stranded DNA-binding protein | - |
CFBP4996_RS05945 (CFBP4996_05945) | 1196652..1199573 | + | 2922 | WP_003525047.1 | excinuclease ABC subunit UvrA | - |
CFBP4996_RS05950 (CFBP4996_05950) | 1199630..1200430 | + | 801 | WP_080852018.1 | DUF72 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10948.68 Da Isoelectric Point: 9.5467
>T274592 WP_080852022.1 NZ_CP120211:c1195459-1195169 [Agrobacterium leguminum]
VNSYRLTKQAESEILDIFIYGVEQFGLRQAHFYKNEMKSCFQLLGDNPRMGRLAPAIGEGVRRHEHGSHIILYEIDGAGV
LILTVVHGRSIRRLKL
VNSYRLTKQAESEILDIFIYGVEQFGLRQAHFYKNEMKSCFQLLGDNPRMGRLAPAIGEGVRRHEHGSHIILYEIDGAGV
LILTVVHGRSIRRLKL
Download Length: 291 bp