Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
Location | 474843..475387 | Replicon | chromosome |
Accession | NZ_CP120211 | ||
Organism | Agrobacterium leguminum strain CFBP4996 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | CFBP4996_RS02305 | Protein ID | WP_162935992.1 |
Coordinates | 475097..475387 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | CFBP4996_RS02300 | Protein ID | WP_080852551.1 |
Coordinates | 474843..475094 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFBP4996_RS02275 (CFBP4996_02275) | 469923..470612 | - | 690 | WP_003520496.1 | HAD family hydrolase | - |
CFBP4996_RS02280 (CFBP4996_02280) | 470835..471515 | + | 681 | WP_059754101.1 | GntR family transcriptional regulator | - |
CFBP4996_RS02285 (CFBP4996_02285) | 471562..472023 | + | 462 | WP_080853232.1 | DUF1284 domain-containing protein | - |
CFBP4996_RS02290 (CFBP4996_02290) | 471983..473083 | - | 1101 | WP_080852552.1 | hypothetical protein | - |
CFBP4996_RS02295 (CFBP4996_02295) | 473322..474467 | + | 1146 | WP_003520492.1 | site-specific DNA-methyltransferase | - |
CFBP4996_RS02300 (CFBP4996_02300) | 474843..475094 | + | 252 | WP_080852551.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
CFBP4996_RS02305 (CFBP4996_02305) | 475097..475387 | + | 291 | WP_162935992.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CFBP4996_RS02310 (CFBP4996_02310) | 475425..476036 | - | 612 | WP_080852549.1 | HAD family phosphatase | - |
CFBP4996_RS02315 (CFBP4996_02315) | 476119..477228 | - | 1110 | WP_080852548.1 | A/G-specific adenine glycosylase | - |
CFBP4996_RS02320 (CFBP4996_02320) | 477355..477819 | + | 465 | WP_035263001.1 | hypothetical protein | - |
CFBP4996_RS02325 (CFBP4996_02325) | 477847..478368 | + | 522 | WP_065116149.1 | DUF721 domain-containing protein | - |
CFBP4996_RS02330 (CFBP4996_02330) | 478498..479178 | + | 681 | WP_072494057.1 | DsbA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11369.13 Da Isoelectric Point: 6.4908
>T274589 WP_162935992.1 NZ_CP120211:475097-475387 [Agrobacterium leguminum]
MGFRLSLLAEEDVIRIVEEGIVLFGLAQAQKYHRELYEIFELISRNPRMARERHELLPPLRIHRFRAHLVVYAVGTDDDV
LIVRVRHAHEDWANEL
MGFRLSLLAEEDVIRIVEEGIVLFGLAQAQKYHRELYEIFELISRNPRMARERHELLPPLRIHRFRAHLVVYAVGTDDDV
LIVRVRHAHEDWANEL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|