Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
| Location | 3341544..3342177 | Replicon | chromosome |
| Accession | NZ_CP120208 | ||
| Organism | Weizmannia coagulans strain HOM5301 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G2TIM0 |
| Locus tag | O2602_RS15975 | Protein ID | WP_013860680.1 |
| Coordinates | 3341544..3341894 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | G2TIL9 |
| Locus tag | O2602_RS15980 | Protein ID | WP_014096808.1 |
| Coordinates | 3341899..3342177 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O2602_RS15940 | 3336799..3337578 | - | 780 | WP_014096815.1 | RNA polymerase sigma factor SigB | - |
| O2602_RS15945 | 3337556..3338026 | - | 471 | WP_026684337.1 | anti-sigma B factor RsbW | - |
| O2602_RS15950 | 3338030..3338365 | - | 336 | WP_026104587.1 | anti-sigma factor antagonist | - |
| O2602_RS15955 | 3338435..3339445 | - | 1011 | WP_276210650.1 | PP2C family protein-serine/threonine phosphatase | - |
| O2602_RS15960 | 3339460..3339861 | - | 402 | WP_014096811.1 | anti-sigma regulatory factor | - |
| O2602_RS15965 | 3339866..3340222 | - | 357 | WP_014096810.1 | STAS domain-containing protein | - |
| O2602_RS15970 | 3340226..3341053 | - | 828 | WP_014096809.1 | RsbT co-antagonist protein RsbRA | - |
| O2602_RS15975 | 3341544..3341894 | - | 351 | WP_013860680.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| O2602_RS15980 | 3341899..3342177 | - | 279 | WP_014096808.1 | hypothetical protein | Antitoxin |
| O2602_RS15985 | 3342330..3343481 | - | 1152 | WP_276210651.1 | alanine racemase | - |
| O2602_RS15990 | 3343682..3344698 | - | 1017 | WP_014096806.1 | outer membrane lipoprotein carrier protein LolA | - |
| O2602_RS15995 | 3344839..3345189 | - | 351 | WP_276210652.1 | holo-ACP synthase | - |
| O2602_RS16000 | 3345470..3346069 | + | 600 | WP_276210653.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12968.01 Da Isoelectric Point: 4.8998
>T274587 WP_013860680.1 NZ_CP120208:c3341894-3341544 [Weizmannia coagulans]
MIVKRGDVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGLERDSVILLEQI
RTIDKQRLTDKITHLDEEVMEKIDDALQISLGLVEF
MIVKRGDVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGLERDSVILLEQI
RTIDKQRLTDKITHLDEEVMEKIDDALQISLGLVEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4BYJ0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4BX66 |