Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 263661..264304 | Replicon | plasmid p514780 |
Accession | NZ_CP119987 | ||
Organism | Salmonella enterica strain CRIN514780 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | P2V97_RS24255 | Protein ID | WP_001044768.1 |
Coordinates | 263888..264304 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | P2V97_RS24250 | Protein ID | WP_001261287.1 |
Coordinates | 263661..263891 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P2V97_RS24235 (259772) | 259772..260860 | + | 1089 | WP_000952231.1 | hypothetical protein | - |
P2V97_RS24240 (260862) | 260862..261731 | + | 870 | WP_000253407.1 | hypothetical protein | - |
P2V97_RS24245 (261788) | 261788..263353 | - | 1566 | WP_000741348.1 | AAA family ATPase | - |
P2V97_RS24250 (263661) | 263661..263891 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
P2V97_RS24255 (263888) | 263888..264304 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
P2V97_RS24260 (264466) | 264466..266604 | - | 2139 | WP_000350635.1 | AAA family ATPase | - |
P2V97_RS24265 (266958) | 266958..267215 | + | 258 | WP_000343085.1 | hypothetical protein | - |
P2V97_RS24270 (267215) | 267215..267805 | + | 591 | WP_000194575.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | ant(3'')-Ia / qacE / sul1 / tet(A) / blaCTX-M-65 / floR / aph(4)-Ia / aac(3)-IVa / aph(3')-Ia | faeC / faeD / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS | 1..312164 | 312164 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T274586 WP_001044768.1 NZ_CP119987:263888-264304 [Salmonella enterica]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |