Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 49897..50422 | Replicon | plasmid p514780 |
| Accession | NZ_CP119987 | ||
| Organism | Salmonella enterica strain CRIN514780 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | A0A5Y5FBU7 |
| Locus tag | P2V97_RS23260 | Protein ID | WP_023994134.1 |
| Coordinates | 50117..50422 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | A0A5T8X4Y4 |
| Locus tag | P2V97_RS23255 | Protein ID | WP_023994135.1 |
| Coordinates | 49897..50115 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P2V97_RS23220 (44929) | 44929..45693 | + | 765 | WP_023994141.1 | minor fimbrial protein | - |
| P2V97_RS23225 (45896) | 45896..46486 | + | 591 | WP_023994140.1 | hypothetical protein | - |
| P2V97_RS23230 (46552) | 46552..46764 | + | 213 | WP_023994139.1 | FaeA/PapI family transcriptional regulator | - |
| P2V97_RS23235 (47025) | 47025..47186 | + | 162 | WP_001816720.1 | hypothetical protein | - |
| P2V97_RS23240 (47212) | 47212..48060 | + | 849 | WP_023994138.1 | SdiA-regulated domain-containing protein | - |
| P2V97_RS23245 (48630) | 48630..49046 | - | 417 | WP_023994137.1 | type II toxin-antitoxin system VapC family toxin | - |
| P2V97_RS23250 (49043) | 49043..49273 | - | 231 | WP_023994136.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| P2V97_RS23255 (49897) | 49897..50115 | + | 219 | WP_023994135.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| P2V97_RS23260 (50117) | 50117..50422 | + | 306 | WP_023994134.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| P2V97_RS23265 (50424) | 50424..50714 | + | 291 | WP_023994133.1 | hypothetical protein | - |
| P2V97_RS23270 (50711) | 50711..50986 | + | 276 | Protein_59 | 3'-5' exonuclease | - |
| P2V97_RS23275 (51057) | 51057..51173 | + | 117 | Protein_60 | hypothetical protein | - |
| P2V97_RS23280 (51163) | 51163..51878 | - | 716 | Protein_61 | transposase | - |
| P2V97_RS23285 (53160) | 53160..53696 | + | 537 | WP_023994130.1 | fimbrial protein | - |
| P2V97_RS23290 (53749) | 53749..54480 | + | 732 | WP_023994129.1 | fimbria/pilus periplasmic chaperone | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | ant(3'')-Ia / qacE / sul1 / tet(A) / blaCTX-M-65 / floR / aph(4)-Ia / aac(3)-IVa / aph(3')-Ia | faeC / faeD / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS | 1..312164 | 312164 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11708.47 Da Isoelectric Point: 6.4685
>T274581 WP_023994134.1 NZ_CP119987:50117-50422 [Salmonella enterica]
MQFKVYTYKRESRYRLFVDVQSDIVDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRLMTTDMASVPASFIGEEV
AELSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIVDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRLMTTDMASVPASFIGEEV
AELSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Y5FBU7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5T8X4Y4 |