Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4297632..4298392 | Replicon | chromosome |
Accession | NZ_CP119986 | ||
Organism | Salmonella enterica strain CRIN514780 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | Q57IH1 |
Locus tag | P2V97_RS20900 | Protein ID | WP_000533909.1 |
Coordinates | 4297632..4298117 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | M7RHS4 |
Locus tag | P2V97_RS20905 | Protein ID | WP_000965886.1 |
Coordinates | 4298105..4298392 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P2V97_RS20870 (4292703) | 4292703..4293365 | + | 663 | WP_000747548.1 | OmpA family lipoprotein | - |
P2V97_RS20875 (4293584) | 4293584..4294558 | + | 975 | WP_023198076.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
P2V97_RS20880 (4294608) | 4294608..4295318 | - | 711 | WP_000190524.1 | DUF3053 domain-containing protein | - |
P2V97_RS20885 (4295757) | 4295757..4296047 | + | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
P2V97_RS20890 (4296335) | 4296335..4296547 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
P2V97_RS20895 (4296721) | 4296721..4297260 | + | 540 | WP_000047148.1 | copper-binding periplasmic metallochaperone CueP | - |
P2V97_RS20900 (4297632) | 4297632..4298117 | - | 486 | WP_000533909.1 | GNAT family N-acetyltransferase | Toxin |
P2V97_RS20905 (4298105) | 4298105..4298392 | - | 288 | WP_000965886.1 | DUF1778 domain-containing protein | Antitoxin |
P2V97_RS20910 (4298558) | 4298558..4299116 | - | 559 | Protein_4078 | cysteine hydrolase | - |
P2V97_RS20915 (4299205) | 4299205..4300407 | - | 1203 | WP_023201740.1 | MFS transporter | - |
P2V97_RS20920 (4300492) | 4300492..4301142 | + | 651 | WP_023993641.1 | GntR family transcriptional regulator | - |
P2V97_RS20925 (4301261) | 4301261..4301689 | - | 429 | Protein_4081 | IS3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17703.41 Da Isoelectric Point: 9.8719
>T274575 WP_000533909.1 NZ_CP119986:c4298117-4297632 [Salmonella enterica]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7F36 | |
PDB | 7AK8 | |
PDB | 5FVJ |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V2JDX2 |