274574

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4185213..4185799 Replicon chromosome
Accession NZ_CP119986
Organism Salmonella enterica strain CRIN514780

Toxin (Protein)


Gene name doc Uniprot ID A0A5Y4K907
Locus tag P2V97_RS20390 Protein ID WP_023202025.1
Coordinates 4185213..4185581 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag P2V97_RS20395 Protein ID WP_023993856.1
Coordinates 4185578..4185799 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P2V97_RS20370 (4180732) 4180732..4181802 - 1071 WP_000907846.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
P2V97_RS20375 (4181804) 4181804..4182649 - 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
P2V97_RS20380 (4182646) 4182646..4183533 - 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
P2V97_RS20385 (4183638) 4183638..4184954 - 1317 WP_023993857.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
P2V97_RS20390 (4185213) 4185213..4185581 - 369 WP_023202025.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
P2V97_RS20395 (4185578) 4185578..4185799 - 222 WP_023993856.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P2V97_RS20400 (4185930) 4185930..4186643 - 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
P2V97_RS20405 (4186645) 4186645..4187412 - 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
P2V97_RS20410 (4187409) 4187409..4188686 - 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
P2V97_RS20415 (4188683) 4188683..4189609 - 927 WP_023183687.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
P2V97_RS20420 (4189669) 4189669..4190778 - 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4179995..4188686 8691


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13703.01 Da        Isoelectric Point: 6.7252

>T274574 WP_023202025.1 NZ_CP119986:c4185581-4185213 [Salmonella enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRWHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0637

>AT274574 WP_023993856.1 NZ_CP119986:c4185799-4185578 [Salmonella enterica]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRDLADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Y4K907

Antitoxin

Source ID Structure

References