Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 263669..264312 Replicon plasmid p508879
Accession NZ_CP119985
Organism Salmonella enterica strain CRIN508879

Toxin (Protein)


Gene name vagD Uniprot ID B1LRW4
Locus tag P2W29_RS24250 Protein ID WP_001044768.1
Coordinates 263896..264312 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag P2W29_RS24245 Protein ID WP_001261287.1
Coordinates 263669..263899 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P2W29_RS24230 (259780) 259780..260868 + 1089 WP_000952231.1 hypothetical protein -
P2W29_RS24235 (260870) 260870..261739 + 870 WP_000253407.1 hypothetical protein -
P2W29_RS24240 (261796) 261796..263361 - 1566 WP_000741348.1 AAA family ATPase -
P2W29_RS24245 (263669) 263669..263899 + 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
P2W29_RS24250 (263896) 263896..264312 + 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin Toxin
P2W29_RS24255 (264474) 264474..266612 - 2139 WP_000350635.1 AAA family ATPase -
P2W29_RS24260 (266966) 266966..267223 + 258 WP_000343085.1 hypothetical protein -
P2W29_RS24265 (267223) 267223..267813 + 591 WP_000194575.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(3'')-Ia / qacE / sul1 / tet(A) / blaCTX-M-65 / fosA3 / floR / aph(4)-Ia / aac(3)-IVa / aph(3')-Ia faeC / faeD / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS 1..315489 315489


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15197.66 Da        Isoelectric Point: 7.7805

>T274562 WP_001044768.1 NZ_CP119985:263896-264312 [Salmonella enterica]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT274562 WP_001261287.1 NZ_CP119985:263669-263899 [Salmonella enterica]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A606Q844

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References