274555

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacT-ataR/DUF1778(antitoxin)
Location 28611..29368 Replicon plasmid p508879
Accession NZ_CP119985
Organism Salmonella enterica strain CRIN508879

Toxin (Protein)


Gene name tacT Uniprot ID A0A241PXX4
Locus tag P2W29_RS23125 Protein ID WP_023994162.1
Coordinates 28886..29368 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name ataR Uniprot ID A0A727Z1I8
Locus tag P2W29_RS23120 Protein ID WP_001195098.1
Coordinates 28611..28895 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P2W29_RS23075 (24452) 24452..24598 - 147 Protein_20 IS66 family insertion sequence element accessory protein TnpB -
P2W29_RS23080 (24585) 24585..24914 - 330 WP_023994169.1 hypothetical protein -
P2W29_RS23085 (25038) 25038..25891 + 854 Protein_22 site-specific tyrosine recombinase XerC -
P2W29_RS23090 (25860) 25860..26147 + 288 WP_031619580.1 damage-inducible protein J -
P2W29_RS23095 (26144) 26144..26449 + 306 WP_023994167.1 type II toxin-antitoxin system RelE/ParE family toxin -
P2W29_RS23100 (27199) 27199..27462 + 264 WP_023994165.1 DUF977 family protein -
P2W29_RS23105 (27488) 27488..27823 + 336 WP_023994164.1 hypothetical protein -
P2W29_RS23110 (28045) 28045..28242 - 198 Protein_27 PIN domain-containing protein -
P2W29_RS23115 (28366) 28366..28455 + 90 WP_071790431.1 helix-turn-helix domain-containing protein -
P2W29_RS23120 (28611) 28611..28895 + 285 WP_001195098.1 DUF1778 domain-containing protein Antitoxin
P2W29_RS23125 (28886) 28886..29368 + 483 WP_023994162.1 GNAT family N-acetyltransferase Toxin
P2W29_RS23130 (29683) 29683..30109 + 427 Protein_31 transposase -
P2W29_RS23135 (30426) 30426..30635 + 210 WP_023994160.1 hemolysin expression modulator Hha -
P2W29_RS23140 (30709) 30709..31061 - 353 Protein_33 transposase -
P2W29_RS23145 (31288) 31288..32261 + 974 Protein_34 IS256 family transposase -
P2W29_RS23150 (32263) 32263..32505 + 243 WP_023994156.1 hypothetical protein -
P2W29_RS23155 (32576) 32576..33532 + 957 WP_023994155.1 Rpn family recombination-promoting nuclease/putative transposase -
P2W29_RS23160 (33591) 33591..33803 + 213 WP_023994154.1 hypothetical protein -
P2W29_RS23165 (33845) 33845..34096 - 252 WP_023994153.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(3'')-Ia / qacE / sul1 / tet(A) / blaCTX-M-65 / fosA3 / floR / aph(4)-Ia / aac(3)-IVa / aph(3')-Ia faeC / faeD / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS 1..315489 315489
- inside IScluster/Tn - - 23156..35660 12504


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(31-149)

Antitoxin

Vibrio phage ICP1, Orf50

(13-88)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17971.54 Da        Isoelectric Point: 6.8521

>T274555 WP_023994162.1 NZ_CP119985:28886-29368 [Salmonella enterica]
MEISVTAPELLNEEHYLQQFDCGNDVLSDWLRRRAMKNQYLNASRTFVICPEGTKRVVGYYSIATGSVSHASLGRSLRQN
MPDPVPVVLLGRLAVDECTQGHSFGKWLLNDAVTRVSNLADQVGIKAIMVHAIDEQAKTFYEYFGFVQSPIAPNTLFYKI

Download         Length: 483 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10964.52 Da        Isoelectric Point: 9.6539

>AT274555 WP_001195098.1 NZ_CP119985:28611-28895 [Salmonella enterica]
MQTTIRKSVRNKQINIRATDEERAVIDYAASLVSKNRTDFIIEKAVSEAQNIILDQRVFVLDDARYQAFIKQLEAPVQNT
EGRQRLMDVKPEWK

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A241PXX4

Antitoxin

Source ID Structure
AlphaFold DB A0A727Z1I8

References