Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 14531..15121 | Replicon | plasmid p508879 |
Accession | NZ_CP119985 | ||
Organism | Salmonella enterica strain CRIN508879 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A241PXU0 |
Locus tag | P2W29_RS23040 | Protein ID | WP_023994178.1 |
Coordinates | 14789..15121 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A5T3Q5H6 |
Locus tag | P2W29_RS23035 | Protein ID | WP_023994179.1 |
Coordinates | 14531..14788 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P2W29_RS23015 (10030) | 10030..11055 | + | 1026 | WP_023994180.1 | IS630 family transposase | - |
P2W29_RS23020 (11059) | 11059..12078 | - | 1020 | WP_223155817.1 | hypothetical protein | - |
P2W29_RS23025 (12218) | 12218..12724 | - | 507 | WP_223155815.1 | hypothetical protein | - |
P2W29_RS23030 (12835) | 12835..13920 | - | 1086 | WP_223155813.1 | hypothetical protein | - |
P2W29_RS23035 (14531) | 14531..14788 | + | 258 | WP_023994179.1 | hypothetical protein | Antitoxin |
P2W29_RS23040 (14789) | 14789..15121 | + | 333 | WP_023994178.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
P2W29_RS23045 (15721) | 15721..16326 | + | 606 | Protein_14 | IS481 family transposase | - |
P2W29_RS23050 (16625) | 16625..18847 | - | 2223 | WP_023994175.1 | DEAD/DEAH box helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | ant(3'')-Ia / qacE / sul1 / tet(A) / blaCTX-M-65 / fosA3 / floR / aph(4)-Ia / aac(3)-IVa / aph(3')-Ia | faeC / faeD / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS | 1..315489 | 315489 | |
- | inside | IScluster/Tn | - | - | 10018..16326 | 6308 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11787.54 Da Isoelectric Point: 9.3417
>T274554 WP_023994178.1 NZ_CP119985:14789-15121 [Salmonella enterica]
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGDFARTAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPEAVVNEVLARLEAILS
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGDFARTAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPEAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A241PXU0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5T3Q5H6 |