Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3655166..3655826 | Replicon | chromosome |
Accession | NZ_CP119984 | ||
Organism | Salmonella enterica strain CRIN508879 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A5I5GR00 |
Locus tag | P2W29_RS17790 | Protein ID | WP_000244761.1 |
Coordinates | 3655166..3655579 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | P2W29_RS17795 | Protein ID | WP_000351186.1 |
Coordinates | 3655560..3655826 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P2W29_RS17770 (3651107) | 3651107..3652840 | - | 1734 | WP_000813387.1 | single-stranded-DNA-specific exonuclease RecJ | - |
P2W29_RS17775 (3652846) | 3652846..3653559 | - | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P2W29_RS17780 (3653583) | 3653583..3654479 | - | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
P2W29_RS17785 (3654592) | 3654592..3655113 | + | 522 | WP_001055885.1 | flavodoxin FldB | - |
P2W29_RS17790 (3655166) | 3655166..3655579 | - | 414 | WP_000244761.1 | protein YgfX | Toxin |
P2W29_RS17795 (3655560) | 3655560..3655826 | - | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
P2W29_RS17800 (3656076) | 3656076..3657056 | + | 981 | WP_023260866.1 | tRNA-modifying protein YgfZ | - |
P2W29_RS17805 (3657172) | 3657172..3657831 | - | 660 | WP_000250289.1 | hemolysin III family protein | - |
P2W29_RS17810 (3657995) | 3657995..3658306 | - | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
P2W29_RS17815 (3658464) | 3658464..3659897 | + | 1434 | WP_001230139.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16199.15 Da Isoelectric Point: 10.7537
>T274549 WP_000244761.1 NZ_CP119984:c3655579-3655166 [Salmonella enterica]
VVLWQSDLRVSWRAQWISLLIHGLVSAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVSAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I5GR00 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |