Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1109741..1110361 | Replicon | chromosome |
Accession | NZ_CP119984 | ||
Organism | Salmonella enterica strain CRIN508879 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | P2W29_RS05205 | Protein ID | WP_001280991.1 |
Coordinates | 1109741..1109959 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | P2W29_RS05210 | Protein ID | WP_000344807.1 |
Coordinates | 1109987..1110361 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P2W29_RS05165 (1104964) | 1104964..1105533 | + | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
P2W29_RS05170 (1105566) | 1105566..1105955 | - | 390 | WP_000961285.1 | MGMT family protein | - |
P2W29_RS05180 (1106186) | 1106186..1107736 | - | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
P2W29_RS05185 (1107961) | 1107961..1108221 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
P2W29_RS05190 (1108227) | 1108227..1108367 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
P2W29_RS05195 (1108423) | 1108423..1108893 | - | 471 | WP_000136183.1 | YlaC family protein | - |
P2W29_RS05200 (1109011) | 1109011..1109562 | - | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
P2W29_RS05205 (1109741) | 1109741..1109959 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
P2W29_RS05210 (1109987) | 1109987..1110361 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
P2W29_RS05215 (1110857) | 1110857..1114006 | - | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
P2W29_RS05220 (1114029) | 1114029..1115222 | - | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T274542 WP_001280991.1 NZ_CP119984:c1109959-1109741 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT274542 WP_000344807.1 NZ_CP119984:c1110361-1109987 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|