Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 263668..264311 | Replicon | plasmid p525628 |
| Accession | NZ_CP119981 | ||
| Organism | Salmonella enterica strain CRIN525628 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | P2V98_RS24250 | Protein ID | WP_001044768.1 |
| Coordinates | 263895..264311 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | P2V98_RS24245 | Protein ID | WP_001261287.1 |
| Coordinates | 263668..263898 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P2V98_RS24230 (259779) | 259779..260867 | + | 1089 | WP_000952231.1 | hypothetical protein | - |
| P2V98_RS24235 (260869) | 260869..261738 | + | 870 | WP_000253407.1 | hypothetical protein | - |
| P2V98_RS24240 (261795) | 261795..263360 | - | 1566 | WP_000741348.1 | AAA family ATPase | - |
| P2V98_RS24245 (263668) | 263668..263898 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| P2V98_RS24250 (263895) | 263895..264311 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P2V98_RS24255 (264473) | 264473..266611 | - | 2139 | WP_000350635.1 | AAA family ATPase | - |
| P2V98_RS24260 (266965) | 266965..267222 | + | 258 | WP_000343085.1 | hypothetical protein | - |
| P2V98_RS24265 (267222) | 267222..267812 | + | 591 | WP_000194575.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | ant(3'')-Ia / qacE / sul1 / tet(A) / blaCTX-M-65 | faeC / faeD / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS | 1..294021 | 294021 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T274514 WP_001044768.1 NZ_CP119981:263895-264311 [Salmonella enterica]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |