Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 4185213..4185799 | Replicon | chromosome |
Accession | NZ_CP119980 | ||
Organism | Salmonella enterica strain CRIN525628 |
Toxin (Protein)
Gene name | doc | Uniprot ID | A0A5Y4K907 |
Locus tag | P2V98_RS20390 | Protein ID | WP_023202025.1 |
Coordinates | 4185213..4185581 (-) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | P2V98_RS20395 | Protein ID | WP_023993856.1 |
Coordinates | 4185578..4185799 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P2V98_RS20370 (4180732) | 4180732..4181802 | - | 1071 | WP_000907846.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
P2V98_RS20375 (4181804) | 4181804..4182649 | - | 846 | WP_000572196.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
P2V98_RS20380 (4182646) | 4182646..4183533 | - | 888 | WP_000099303.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
P2V98_RS20385 (4183638) | 4183638..4184954 | - | 1317 | WP_023993857.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
P2V98_RS20390 (4185213) | 4185213..4185581 | - | 369 | WP_023202025.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
P2V98_RS20395 (4185578) | 4185578..4185799 | - | 222 | WP_023993856.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P2V98_RS20400 (4185930) | 4185930..4186643 | - | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
P2V98_RS20405 (4186645) | 4186645..4187412 | - | 768 | WP_000082083.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
P2V98_RS20410 (4187409) | 4187409..4188686 | - | 1278 | WP_000803764.1 | branched chain amino acid ABC transporter permease LivM | - |
P2V98_RS20415 (4188683) | 4188683..4189609 | - | 927 | WP_023183687.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
P2V98_RS20420 (4189669) | 4189669..4190778 | - | 1110 | WP_000822976.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4179995..4188686 | 8691 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13703.01 Da Isoelectric Point: 6.7252
>T274502 WP_023202025.1 NZ_CP119980:c4185581-4185213 [Salmonella enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRWHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRWHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|