Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3487818..3488632 | Replicon | chromosome |
Accession | NZ_CP119980 | ||
Organism | Salmonella enterica strain CRIN525628 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A5T8FHB0 |
Locus tag | P2V98_RS17015 | Protein ID | WP_023994249.1 |
Coordinates | 3488105..3488632 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | P2V98_RS17010 | Protein ID | WP_000855694.1 |
Coordinates | 3487818..3488108 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P2V98_RS16980 (3483768) | 3483768..3484418 | - | 651 | WP_001728903.1 | type III secretion system transcriptional activator InvF | - |
P2V98_RS16985 (3484874) | 3484874..3485317 | + | 444 | WP_023993678.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
P2V98_RS16990 (3485749) | 3485749..3486198 | + | 450 | WP_000381612.1 | membrane protein | - |
P2V98_RS16995 (3486183) | 3486183..3486530 | + | 348 | WP_001669174.1 | DUF1493 family protein | - |
P2V98_RS17000 (3486803) | 3486803..3487129 | - | 327 | WP_000393300.1 | hypothetical protein | - |
P2V98_RS17005 (3487370) | 3487370..3487548 | + | 179 | Protein_3316 | IS3 family transposase | - |
P2V98_RS17010 (3487818) | 3487818..3488108 | + | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
P2V98_RS17015 (3488105) | 3488105..3488632 | + | 528 | WP_023994249.1 | GNAT family N-acetyltransferase | Toxin |
P2V98_RS17020 (3488705) | 3488705..3488922 | - | 218 | Protein_3319 | IS5/IS1182 family transposase | - |
P2V98_RS17025 (3489257) | 3489257..3489913 | + | 657 | WP_000420451.1 | protein-serine/threonine phosphatase | - |
P2V98_RS17030 (3490084) | 3490084..3490605 | - | 522 | WP_023994250.1 | hypothetical protein | - |
P2V98_RS17035 (3490764) | 3490764..3493331 | + | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 3488705..3488845 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19025.89 Da Isoelectric Point: 9.6423
>T274500 WP_023994249.1 NZ_CP119980:3488105-3488632 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHALQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNNQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHALQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNNQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5T8FHB0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |