Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2142349..2142871 | Replicon | chromosome |
Accession | NZ_CP119980 | ||
Organism | Salmonella enterica strain CRIN525628 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | P2V98_RS10385 | Protein ID | WP_000221343.1 |
Coordinates | 2142349..2142633 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | A0A5X3FYG4 |
Locus tag | P2V98_RS10390 | Protein ID | WP_000885426.1 |
Coordinates | 2142623..2142871 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P2V98_RS10365 (2138428) | 2138428..2139936 | - | 1509 | WP_023993260.1 | FAD-dependent oxidoreductase | - |
P2V98_RS10370 (2139981) | 2139981..2140469 | + | 489 | WP_001293634.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
P2V98_RS10375 (2140662) | 2140662..2141741 | + | 1080 | WP_278276657.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
P2V98_RS10380 (2141789) | 2141789..2142178 | - | 390 | WP_023993262.1 | RidA family protein | - |
P2V98_RS10385 (2142349) | 2142349..2142633 | - | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P2V98_RS10390 (2142623) | 2142623..2142871 | - | 249 | WP_000885426.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P2V98_RS10395 (2143023) | 2143023..2143238 | + | 216 | WP_023993263.1 | phage protein | - |
P2V98_RS10400 (2143228) | 2143228..2143560 | + | 333 | WP_000253154.1 | DUF1493 family protein | - |
P2V98_RS10405 (2143840) | 2143840..2144034 | + | 195 | Protein_2028 | hypothetical protein | - |
P2V98_RS10410 (2144033) | 2144033..2144479 | - | 447 | Protein_2029 | helix-turn-helix domain-containing protein | - |
P2V98_RS10415 (2145385) | 2145385..2146293 | + | 909 | WP_023994284.1 | LysR family transcriptional regulator | - |
P2V98_RS10420 (2146467) | 2146467..2147447 | + | 981 | WP_023993266.1 | nitronate monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2136991..2149176 | 12185 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T274495 WP_000221343.1 NZ_CP119980:c2142633-2142349 [Salmonella enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5X3FYG4 |