Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 212136..212652 | Replicon | chromosome |
Accession | NZ_CP119967 | ||
Organism | Pseudomonas sp. A34-9 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2S9B813 |
Locus tag | P3G59_RS00905 | Protein ID | WP_064389059.1 |
Coordinates | 212371..212652 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | P3G59_RS00900 | Protein ID | WP_095122322.1 |
Coordinates | 212136..212381 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P3G59_RS00865 | 207339..207944 | + | 606 | WP_277760084.1 | adenylyl-sulfate kinase | - |
P3G59_RS00870 | 207941..208726 | + | 786 | WP_277760085.1 | aspartyl/asparaginyl beta-hydroxylase domain-containing protein | - |
P3G59_RS00875 | 208714..209658 | + | 945 | WP_277760086.1 | sulfotransferase family protein | - |
P3G59_RS00880 | 209739..210497 | - | 759 | WP_007917711.1 | slipin family protein | - |
P3G59_RS00885 | 210500..211030 | - | 531 | WP_277760087.1 | NfeD family protein | - |
P3G59_RS00890 | 211205..211666 | + | 462 | WP_095047033.1 | YbaK/EbsC family protein | - |
P3G59_RS00895 | 211796..212041 | + | 246 | WP_277760088.1 | DUF2789 domain-containing protein | - |
P3G59_RS00900 | 212136..212381 | + | 246 | WP_095122322.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P3G59_RS00905 | 212371..212652 | + | 282 | WP_064389059.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P3G59_RS00910 | 212796..213224 | + | 429 | WP_277760089.1 | winged helix DNA-binding protein | - |
P3G59_RS00915 | 213221..215284 | + | 2064 | WP_277760090.1 | FUSC family protein | - |
P3G59_RS00920 | 215281..215490 | + | 210 | WP_007917703.1 | DUF1656 domain-containing protein | - |
P3G59_RS00925 | 215487..216389 | + | 903 | WP_277760091.1 | HlyD family secretion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10817.72 Da Isoelectric Point: 10.6086
>T274486 WP_064389059.1 NZ_CP119967:212371-212652 [Pseudomonas sp. A34-9]
MTYKLEFLPSAHKEWNKLGHTLREQFKKKLGERLKLPRVSADALHGMPDCYKIKLKASGYRLVYQVIDERVVVSVVAVGK
RERSSVYENAKKR
MTYKLEFLPSAHKEWNKLGHTLREQFKKKLGERLKLPRVSADALHGMPDCYKIKLKASGYRLVYQVIDERVVVSVVAVGK
RERSSVYENAKKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|