Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 23380..24014 | Replicon | plasmid pOB3b_01 |
| Accession | NZ_CP119870 | ||
| Organism | Methylosinus trichosporium OB3b | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A1A6FHD3 |
| Locus tag | P3C36_RS21470 | Protein ID | WP_003612723.1 |
| Coordinates | 23380..23781 (-) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A1A6FGH4 |
| Locus tag | P3C36_RS21475 | Protein ID | WP_003612725.1 |
| Coordinates | 23778..24014 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3C36_RS21460 | 21237..22157 | + | 921 | WP_003612721.1 | DNA-binding response regulator | - |
| P3C36_RS21465 | 22264..23322 | + | 1059 | WP_003612722.1 | DUF2252 family protein | - |
| P3C36_RS21470 | 23380..23781 | - | 402 | WP_003612723.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P3C36_RS21475 | 23778..24014 | - | 237 | WP_003612725.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..285789 | 285789 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 13934.03 Da Isoelectric Point: 6.7108
>T274484 WP_003612723.1 NZ_CP119870:c23781-23380 [Methylosinus trichosporium OB3b]
MTRYLLDTNIVSDLIRNPRGRVAAHIAHVGEANVCTSVIVAAELRYGCAKSGSKRLSAAVESLLGELAVLALEGPAAAEY
GAIRAGLERRGTPIGGNDLLIAAHALAIDATVVTANMDEFARVEGLKVQNWLA
MTRYLLDTNIVSDLIRNPRGRVAAHIAHVGEANVCTSVIVAAELRYGCAKSGSKRLSAAVESLLGELAVLALEGPAAAEY
GAIRAGLERRGTPIGGNDLLIAAHALAIDATVVTANMDEFARVEGLKVQNWLA
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1A6FHD3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1A6FGH4 |